KEGG   Capnocytophaga canimorsus: Ccan_03160Help
Entry
Ccan_03160        CDS       T01582                                 

Definition
Uroporphyrinogen-III cosynthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ccan_03160
Enzymes [BR:ccm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Ccan_03160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
340966..341712
Genome map
AA seq 248 aa AA seqDB search
MKVKTILVSQPEPNAENSPYAQIIENQKVKVDFRPFIAVEGVTAKDIRRQKIDLTKFTAI
ILTSRKAVDHYFRIAEEMRFKVPDTMKYFCQSEAVAFYLQKYITYRKRKIYVGKKDFADL
LVLMKKYKDEQFLLPGSDVLKPEIPIALNDLKIKWERGVFYRTVHCDLSDLKAIDYDILA
FFSPSGIESLFKNFPDFKQEKTRIAVFGDSTMKAAQEAGLNIDIKAPAPGVPSMTMALEQ
YISKVNKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaactattttagtttcacaaccagaacccaatgcggagaattctccttat
gctcaaattatagaaaatcaaaaggttaaggttgatttcagaccttttattgctgtggaa
ggagtaacagcaaaagatattcgacgacaaaaaatagatttaaccaaattcacagccatc
attctgaccagtcgtaaagcggttgaccattatttccgaattgcggaagagatgcgcttc
aaagtacctgatacgatgaagtacttctgccaatccgaagccgtagctttttatttacaa
aaatatataacttacagaaaaagaaagatttatgtaggtaaaaaagattttgcggatttg
ctcgttttgatgaaaaaatacaaagatgagcaatttttacttccagggtcagatgtgttg
aaacctgaaattccaattgcattgaatgatttgaaaatcaagtgggaacgaggggttttc
tatcgtaccgtacattgtgatttatcggatttaaaagcgattgattacgatattttagct
ttttttagtccttcaggcattgaatcgctgtttaagaattttcctgattttaagcaagag
aaaacgcgtatagctgtttttggtgattctacgatgaaagctgctcaagaggctgggttg
aatattgatatcaaagcacccgcaccaggagttccttctatgacaatggctctggaacaa
tatattagtaaagtgaacaaaaaataa

DBGET integrated database retrieval system