KEGG   Capnocytophaga canimorsus: Ccan_03840Help
Entry
Ccan_03840        CDS       T01582                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ccan_03840
Enzymes [BR:ccm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Ccan_03840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(427345..428019)
Genome map
AA seq 224 aa AA seqDB search
MKNEQISQEDFLGENHISTSAKTPLRDDAFELSEEEKIARIEKAMADIMHTLGLDLTDDS
LKGTPRRVAKAYVKEIFGGLNPSRKPGSSTFANNYHYGEMLVEKNIVVYSTCEHHFLPIV
GRAHVGYISNGKVIGLSKMNRIVEYFAKRPQVQERLTMQIVQEMQKVLGTEDVACVIDAK
HLCVNSRGIKDIESSTVTAEFGGKFKDLAVRKEFLDYIKLETKY
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgagcaaatttctcaggaagacttccttggagaaaatcacataagtacttct
gcaaaaacgcctcttcgtgatgatgcttttgagctttcggaggaagaaaaaatcgcccga
attgaaaaagcaatggcagatattatgcacactttagggcttgacctaaccgatgatagc
cttaaaggaacgcctcggcgcgtagctaaggcttatgttaaggaaatcttcggagggcta
aatccttcacgtaaacctggttcttccacctttgccaataattaccattatggcgagatg
cttgtggagaaaaacatcgtggtgtattccacttgtgagcatcattttttgcccattgtg
ggtagagctcacgtagggtatatttccaacggaaaggttattgggctgtctaaaatgaac
cgaattgtagaatattttgccaaacgtccacaagtgcaggagcgccttacgatgcaaatc
gtacaggaaatgcaaaaagtactcggtacggaagatgtagcttgtgtgatagatgccaag
catttgtgtgtaaactcacgaggaatcaaagacattgaaagtagcaccgtaactgcggaa
tttggcggaaaattcaaagaccttgccgtaagaaaagaattccttgactacataaaacta
gaaactaagtactaa

DBGET integrated database retrieval system