KEGG   Capnocytophaga canimorsus: Ccan_03850Help
Entry
Ccan_03850        CDS       T01582                                 

Definition
(RefSeq) Porphobilinogen synthase (EC:4.2.1.24)
  KO
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ccan_03850
Enzymes [BR:ccm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Ccan_03850
Exosome [BR:ccm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ccan_03850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(428240..429229)
Genome map
AA seq 329 aa AA seqDB search
MYPLRRNRRLRTSEAIRSLVRETIVTPDDFLVPLFVVEGKGVKEEIASMPNYYRYSLDLL
EKEVKELWKLGLKSVLLFVKVPDNLKDNKGTEAVNPNGLMQRAIKTVKNAVPQMLVMTDV
ALDPYSVYGHDGIIENGQIANDATVDALCQMSLSHAQAGADFVAPSDMMDGRILNIRETL
ENNDFQNVGIMSYSAKYASSFYGPFRDALDSAPVDIQDIPKDKKTYQMDYHNRLEALRET
RMDIEEGADIVMVKPGLCYLDIVREVKNMSEVPVAVYQVSGEYAMLKAAAEKGWLNHDAV
MLEQVTAIKRAGADIIASYFAKEVAKLIG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtatccattaagaagaaaccgaagattgcgtaccagcgaggctattcgcagcttggtc
agagaaactatcgttacgcccgatgattttttggtgccactttttgtggtggaaggcaaa
ggtgtaaaagaagaaatcgcttcaatgccaaattattatcgatatagcttggatttactt
gaaaaagaggtaaaagaactttggaaattaggtttgaagtcggtactattgtttgtgaaa
gttcctgataatttgaaagataacaaaggaacagaagctgtaaatcccaatggactgatg
caaagagccatcaaaacggtaaaaaatgctgttccgcaaatgctggtaatgaccgacgtg
gcactcgacccatattctgtttacggacacgacggaattatcgaaaatgggcaaattgcc
aatgatgcaaccgttgatgccctttgccaaatgagcttatcacacgcccaagcaggtgcc
gatttcgtagcaccaagtgatatgatggacggaagaatattgaacattcgtgaaacgctg
gaaaataatgatttccagaatgttggcataatgtcgtatagtgccaaatatgcgtcttct
ttttatggtcctttccgtgatgcgttggatagtgctcctgttgacattcaagatattcca
aaggataaaaaaacgtatcaaatggattatcacaatcgtttggaagccctcagagaaaca
cgaatggatattgaagaaggtgcagatattgtgatggttaagccaggattatgctatttg
gatattgttcgggaagtaaaaaatatgtcagaagttcctgtggcggtatatcaagtttcg
ggcgaatacgcaatgcttaaagccgcagccgaaaaaggttggctcaatcacgatgcggta
atgctcgaacaagtgaccgctatcaaaagagcgggagcagacattatagcttcttatttt
gccaaagaggtcgctaaactaataggttaa

DBGET integrated database retrieval system