KEGG   Capnocytophaga canimorsus: Ccan_03860Help
Entry
Ccan_03860        CDS       T01582                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ccan_03860
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Ccan_03860
Enzymes [BR:ccm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Ccan_03860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(429278..431605)
Genome map
AA seq 775 aa AA seqDB search
MKVGIIFLSLLWALQSCTSVEKEIISADTNVSIIPQVANIELGSTFFEFDANTKFVANDE
NQQKAISLLNEKFQKAAGWQLQRSATANNSTENNSTENVVVFTQNSNHQAEAYTLEISEK
RIEIQSNDYRGYVHAIQTLRLLLPQNIESEQKQQTAWRVPTLKITDQPRFLWRGLMLDVA
RHFFDKAYILKTIDVMAMLKLNVLHLHLVDDQGWRLEIKKYPKLTEIGAWRVDQENKHWD
ARSKNNPSEQGTYGGFYTQEDIRQIVAYARKRGIEVMPEIEMPAHVTSAIAAYPKLSCHK
QPVAVPSGGVWPITDIYCAGQEQTFTFLEEVLTEVMELFPFEYIHIGGDEATKTEWKKCK
DCQRRIKDHKLKDEHELQSYFIKRIDTFLSSKGKKLVGWDEIIEGGLPKNATVMSWRGFD
GGIKASELGNDVIMTPGDFCYLDQYQGDPEKEPLTIGGNVPLSKVYTFDPILEEMTSEQK
QHILGGQGNLWSEYVTAPAESQYMIFPRILALSEALWSPNSVKNWEDFVKRTEALFHRLD
VMGINYAKSMYQVQIRETITEAGKVEITLQSEYPNADIRYAIADGNYQKYTSPFQINQSE
KIRAVVFKNEAPFGAVSQKEVRFHKAVGKKVSFENPYHKNYQGQQEATLTNIVRGSKNFH
DKQWLAWLVDDASFVIDLEESTLIENVLLGVMENQGQGIYYPTQVAVSLSQDGKKYIPVG
VFNRAFEKNGYAVITDFEIKFAPQKARFVKIKVTNLGNPPKGGDAWLFIDEVSIQ
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagggattatttttttatctttattatgggctttgcagagttgtacatctgtt
gaaaaagaaatcatttctgcagatacaaatgtttcgataataccgcaagttgccaatatt
gagttgggtagtactttttttgaatttgatgccaataccaaatttgtagctaatgatgaa
aatcagcagaaggctatatcattactcaatgaaaaatttcaaaaggcagcaggttggcaa
ctgcaaagaagtgctacggcaaataattctactgaaaataattctactgaaaatgtggtt
gtttttacccaaaattcaaaccatcaagcagaagcctataccttggaaatctctgaaaaa
cgaatagaaattcaatccaatgattatcgtggttacgtacacgccatacaaactttaagg
cttttattacctcaaaatattgaaagtgagcaaaaacaacaaaccgcttggcgagttcct
accttgaagataactgaccaacctcgttttttatggagaggattgatgcttgatgtggct
cggcacttttttgataaagcctatattttaaaaaccattgatgtaatggcgatgcttaag
ttaaatgtattacacctacatttggtggatgaccaagggtggcgccttgaaataaaaaaa
tatccgaaactcactgaaataggagcttggcgcgttgatcaagaaaataagcattgggat
gcacgttcaaaaaacaatccctctgagcaaggcacctacggaggattttatacccaagaa
gatattcgccaaattgtggcttatgcccgtaagcgaggaattgaagtgatgcctgaaata
gaaatgcctgctcacgtaaccagtgccattgcagcttatccgaagctctcttgccataag
caacctgtggcagtaccttcgggaggagtttggcctattactgatatttattgtgctgga
caagagcaaacatttacctttttagaagaagttttaaccgaagttatggaacttttccct
tttgagtacattcatatcggaggagatgaagcaaccaaaaccgaatggaaaaaatgtaag
gattgtcagcgtcgtataaaagatcataaattgaaagacgaacacgagctccaaagctat
tttatcaaaaggatagatacttttctttcttccaaagggaaaaaattagtcggttgggac
gaaatcatagagggtggactacctaaaaatgccacagtaatgagttggcgaggatttgat
ggaggcataaaagcctccgaattaggtaatgatgtaattatgaccccaggtgatttttgc
tacttagatcagtatcaaggtgatcccgaaaaagaacctttaaccattggtggaaatgta
cctttgagcaaggtatatacctttgaccccattttagaggaaatgacttctgaacaaaaa
caacatattttaggagggcaaggtaatttatggtcggaatatgtaaccgcacctgctgaa
tctcaatatatgattttccccagaattttggcactttcagaggctttatggagtccaaat
tccgtaaagaattgggaggattttgtaaaacgtaccgaggcacttttccatcgattggac
gtaatgggtattaattatgccaaatcaatgtatcaggtacaaatccgtgaaaccatcacc
gaagcaggaaaagttgaaattactttacagagtgaatatcctaatgccgacattcgttat
gccattgcagatggcaactatcagaaatacacatcgccttttcaaatcaatcaatctgaa
aaaatacgtgcagtagtgtttaaaaacgaagctcccttcggtgcggtttctcaaaaagag
gtacgctttcataaggcggtaggcaaaaaggtatcttttgaaaatccgtatcataaaaat
tatcaagggcaacaagaagccacactgaccaatattgtgcgtggctctaaaaattttcac
gacaaacaatggttagcttggttagtcgatgatgcctcttttgttattgaccttgaagag
agtacccttattgaaaatgtacttttaggggtgatggaaaatcaaggacaaggaatttat
tacccaacccaagtagcggtttctctttcgcaagatggcaagaaatacattccagtaggt
gtttttaatcgagcttttgaaaaaaacggatatgcagtaatcactgattttgaaattaag
tttgctcctcaaaaagcgcgttttgtaaaaataaaggtaaccaatttaggcaatccgcca
aaaggtggtgatgcgtggctctttattgatgaagtttcaattcaataa

DBGET integrated database retrieval system