KEGG   Capnocytophaga canimorsus: Ccan_04760Help
Entry
Ccan_04760        CDS       T01582                                 

Definition
hydroxymethylbilane hydrolyase (cyclizing) (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ccm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
521644..522294
Genome map
AA seq 216 aa AA seqDB search
MRILLATKILSETQKKSFEYSDFQIIQHDFITIKHSAILPQITGDILLFTSQNAVRSVLK
SQMLLHLKSIPAVCVGEKTAKLLKENGWKVLFFKPYAADLAVEILQKIGHRKITFFCGNL
RRDTLPDFFNKHNLAFEEIQVYQTHYTPETISEKVYGILFFSPSEVKSYLLKNSITTQIL
FCIGTTTAQEAQKHSLKVVIADSPTVESVIAKCLEY
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatccttcttgctaccaaaatactttcagaaacacaaaaaaaatcttttgaatat
tctgattttcaaattatacaacacgatttcataactattaagcatagtgctatattgcca
caaatcacaggcgatatattgctttttaccagtcaaaatgcggtaagaagtgttttaaaa
agccaaatgcttcttcatttaaaaagcatacctgccgtttgtgtaggagaaaagacagcc
aaattactgaaagaaaatggttggaaagtccttttctttaagccttatgctgccgatttg
gctgtggaaattttgcaaaaaatagggcatcggaaaataacttttttctgcggaaacctg
cgccgtgacacgcttcctgatttttttaacaaacataacctcgcctttgaagagatacag
gtgtaccaaacccattatacgccagagacaatatccgaaaaagtctatggcattctgttt
ttcagcccctctgaggttaaaagttacttacttaaaaattcaataaccactcaaatactt
ttttgtatcggcaccactactgctcaagaggctcaaaaacactccctaaaagtggttata
gctgactcgcctaccgtggaaagtgtaatagccaaatgtttggaatattaa

DBGET integrated database retrieval system