KEGG   Capnocytophaga canimorsus: Ccan_04760Help
Entry
Ccan_04760        CDS       T01582                                 

Definition
hydroxymethylbilane hydrolyase (cyclizing) (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ccan_04760
Enzymes [BR:ccm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Ccan_04760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
521644..522294
Genome map
AA seq 216 aa AA seqDB search
MRILLATKILSETQKKSFEYSDFQIIQHDFITIKHSAILPQITGDILLFTSQNAVRSVLK
SQMLLHLKSIPAVCVGEKTAKLLKENGWKVLFFKPYAADLAVEILQKIGHRKITFFCGNL
RRDTLPDFFNKHNLAFEEIQVYQTHYTPETISEKVYGILFFSPSEVKSYLLKNSITTQIL
FCIGTTTAQEAQKHSLKVVIADSPTVESVIAKCLEY
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatccttcttgctaccaaaatactttcagaaacacaaaaaaaatcttttgaatat
tctgattttcaaattatacaacacgatttcataactattaagcatagtgctatattgcca
caaatcacaggcgatatattgctttttaccagtcaaaatgcggtaagaagtgttttaaaa
agccaaatgcttcttcatttaaaaagcatacctgccgtttgtgtaggagaaaagacagcc
aaattactgaaagaaaatggttggaaagtccttttctttaagccttatgctgccgatttg
gctgtggaaattttgcaaaaaatagggcatcggaaaataacttttttctgcggaaacctg
cgccgtgacacgcttcctgatttttttaacaaacataacctcgcctttgaagagatacag
gtgtaccaaacccattatacgccagagacaatatccgaaaaagtctatggcattctgttt
ttcagcccctctgaggttaaaagttacttacttaaaaattcaataaccactcaaatactt
ttttgtatcggcaccactactgctcaagaggctcaaaaacactccctaaaagtggttata
gctgactcgcctaccgtggaaagtgtaatagccaaatgtttggaatattaa

DBGET integrated database retrieval system