KEGG   Capnocytophaga canimorsus: Ccan_05290Help
Entry
Ccan_05290        CDS       T01582                                 

Definition
Nicotine deamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Ccan_05290
Enzymes [BR:ccm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Ccan_05290
    3.5.1.-  
     Ccan_05290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
585256..585873
Genome map
AA seq 205 aa AA seqDB search
MALNKKRFMKALILIDIQNDFMPGGALAVSQGDEIIPFVNDAIQSDYDLVVATQDWHPLS
HKSFASNHKDKKVFDIIDLHGIKQVLWPNHCVQGTSGADLHPQLQTEKIEAIFRKGTNLE
IDSYSAFFDNNRKNSTGLHGYLQEKGIKSLTFCGLAGDFCVAYSVNDALSLGYEVRLLQA
AIRSISVQTYAEYVKTWKSKGIQFI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttggctttgaataaaaaacgttttatgaaagcactaattttaattgatattcagaatgat
tttatgccaggaggagctttagctgttagccaaggcgatgaaattattccttttgttaat
gacgctatacaatctgactatgatttggtggtagctacacaagattggcatcctttaagt
cacaagagttttgcctcaaatcataaagacaaaaaggtattcgatatcattgatttacac
ggaataaaacaggtactttggcctaatcattgcgtacaaggaacttctggtgccgatttg
catccgcaattgcagactgaaaaaatagaggctatcttccgtaagggtacaaatttagaa
attgacagctacagcgctttttttgataacaatcgaaaaaatagtacaggactacacggc
tatttacaagaaaaaggtataaaatcactcactttttgtggtttagctggtgatttttgt
gttgcatacagtgtaaatgacgcactttcgttaggatatgaagttcgtttactacaagcc
gctatacgctctatttctgtgcaaacgtatgctgaatatgtcaaaacttggaaatcaaaa
ggcatacaattcatttaa

DBGET integrated database retrieval system