KEGG   Capnocytophaga canimorsus: Ccan_06010Help
Entry
Ccan_06010        CDS       T01582                                 

Definition
(GenBank) Acetohydroxy-acid synthase small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
ccm  Capnocytophaga canimorsus
Pathway
ccm00290  Valine, leucine and isoleucine biosynthesis
ccm00650  Butanoate metabolism
ccm00660  C5-Branched dibasic acid metabolism
ccm00770  Pantothenate and CoA biosynthesis
ccm01100  Metabolic pathways
ccm01110  Biosynthesis of secondary metabolites
ccm01130  Biosynthesis of antibiotics
ccm01210  2-Oxocarboxylic acid metabolism
ccm01230  Biosynthesis of amino acids
Module
ccm_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ccm_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Ccan_06010
   00660 C5-Branched dibasic acid metabolism
    Ccan_06010
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Ccan_06010
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Ccan_06010
Enzymes [BR:ccm01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     Ccan_06010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4
Motif
Other DBs
NCBI-ProteinID: AEK22721
UniProt: F9YSP8
Position
complement(640224..640763)
Genome map
AA seq 179 aa AA seqDB search
MEQKTYTITIYSENQLGLLNRVTGIFLRRHIDMESINVSASEIDNVFRMIIVTHTTQKWV
EHLVQQIEKQIEIIKVFYHTDEEIISLENSLFKMPTASLFDEETPIQAIIQRYNANIVAV
YKHFYVISKTGSRESIAALYQELKPYGIMQFSGSARIAISKSEMKVSPLLNKYEVDNQK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaaaacatacaccatcaccatatattcggaaaatcagcttgggctactcaac
agagtgacagggattttcctaagaagacatattgatatggaaagcatcaatgtgtcggca
tcggaaattgacaatgtatttcgaatgattattgtgactcataccactcaaaaatgggta
gaacatttggttcaacagattgaaaaacagatagaaatcatcaaagtattttatcatacc
gatgaagaaatcatttcccttgaaaattcacttttcaaaatgcctacggcttcccttttt
gatgaagaaactcccattcaagctataattcagcgatataatgctaatattgttgctgtt
tataaacatttttatgtaatttcaaaaacaggctcacgagagtccatcgcagcactttat
caggagctgaaaccttacggaattatgcaattttcgggctcggcacgaattgctatttca
aaatcggaaatgaaagtatcgcccttgctcaacaaatatgaggtagataaccaaaaatag

DBGET integrated database retrieval system