KEGG   Capnocytophaga canimorsus: Ccan_06330Help
Entry
Ccan_06330        CDS       T01582                                 

Definition
Ketopantoate hydroxymethyltransferase (EC:2.1.2.11)
Orthology
K00606  
3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Ccan_06330
Enzymes [BR:ccm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     Ccan_06330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
674705..675568
Genome map
AA seq 287 aa AA seqDB search
MYVIFHYLWSLKNENMSVAKKEYKRVTTNSLVTMKASGEKISMLTAYDYTLAKIIDAAGI
DVILVGDSASNVMAGHETTLPITLEQMIYHAASVVRAASRALVVVDLPFGTYQSDSKQAL
RSAIRIMKESGGHALKLEGGKEIKDSVKRIIKAGIPVMGHLGLTPQSIYKFGTYTVRAKE
EAEAQKLKEDALLLQKLGCFAIVLEKVPAKLAQEVAESLTIPVIGIGAGSGVDGQVLVLH
DMLGMTHEFHPRFLRRYANLYEEITSSVSRYVEDVKNVDFPSKEESY
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtgatttttcactacctttggtcgcttaaaaatgaaaatatgtcagtagcaaaa
aaagaatataaaagggtgactactaattcattggttacaatgaaggcaagtggtgaaaaa
atttcgatgcttaccgcttacgattatactttggcaaaaattattgatgccgctggaata
gatgttattttggtaggcgattcagcgagtaacgttatggcagggcacgaaactacctta
cccatcaccttggaacaaatgatttatcacgcagcttcagtggtacgtgcggcttcaagg
gcgctggtggtagtagatttacccttcggaacttatcaatccgattcgaaacaagcactt
cgttccgccatccgaattatgaaagaaagtggtggacacgctcttaaacttgaaggtgga
aaagaaataaaagatagcgtaaaaagaataatcaaagcgggaattccagtaatggggcat
ttggggctcactccgcaatctatttataagtttggtacctacacggttcgagctaaagaa
gaagcagaggctcagaaacttaaagaggacgctcttctgttacaaaaattgggatgtttt
gctattgttttggaaaaggtacctgcaaaattagctcaagaagtagccgaaagtcttacc
attcctgtaattggaattggtgcgggtagtggcgtggacggacaagtattggtacttcac
gatatgctcggaatgacccacgaatttcatccgcgttttttgagacgttatgccaatttg
tatgaggaaattacctcttcggtatcacgctatgtagaggatgttaaaaacgtagatttc
ccaagtaaggaagaatcatattaa

DBGET integrated database retrieval system