KEGG   Capnocytophaga canimorsus: Ccan_07050Help
Entry
Ccan_07050        CDS       T01582                                 

Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase complex component E2 (EC:2.3.1.12)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ccan_07050
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ccan_07050
  Amino acid metabolism
   00310 Lysine degradation
    Ccan_07050
Enzymes [BR:ccm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ccan_07050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(761136..762674)
Genome map
AA seq 512 aa AA seqDB search
MGAFRYLTEILPFITKIIFENTMAKYELRLPQMGESVAEATITAWLKKVGDTIEAEESIV
EVATDKVDSEIPSEVSGVITEILFEVDQVVKIGQVMAIIETEQTQEAPSTEELSAEFEQQ
PTNQTFQSPTFDNPFEVAYKLSNPEPEQVSTETTTDYNFPPELDRFYSPLVKSIAKKEGI
SLLELNKILGTGADNRVTKDDILMYLESRRVLQETSSETTPTPLEKASEETPISQIAEQV
PFVPTQMKTYDSVPSITPMEEKQSESEKTDAKSLTATGDEIIEMTRMGKMISEHMTRSKQ
TSAHVQSFTEVDVTRIWNWRNKVKKAFETREGEKFTFTPIFMEAVTQALKDYPMMNISVE
DTKIIKKKNINIGMATALPDGNLIVPVIKNADQLSLRGMAKVVNDLATRARAGQLKPDEV
KDGTYTVTNIGSFGNVFGTPIINQPQVGILAIGAIRKVPAVIETPDGDLIGIRYKMMLSH
SYDHRVVNGALGGMFVQRVAEYLEHWDITREV
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
ttgggggctttccgatatctgacggaaatactaccattcattactaaaataatttttgaa
aatacaatggctaaatatgaattaagattgcctcaaatgggcgaaagtgttgctgaagct
accattacagcttggcttaaaaaagtaggtgatacaattgaagcagaagaaagtattgtt
gaggtggctaccgataaggtggattcagaaattccttcagaagttagtggcgtaattact
gaaattttgtttgaggttgaccaagtggtgaaaattgggcaggtaatggccattatcgaa
acggaacaaactcaagaagccccctccacagaggaattatctgctgagtttgagcaacaa
cctactaatcaaacgttccaaagccccacttttgacaatccgtttgaggttgcctataag
ctatccaaccctgaaccagagcaagtttctaccgagaccacaaccgactataacttccca
cccgagcttgatcgtttctattcgcctttagtaaaaagcatcgctaaaaaagagggcatt
tccttattagaacttaacaaaatattaggtacaggggcagataatcgtgtaaccaaagac
gatatcttgatgtatttggaaagccgtcgtgtactacaagaaacttcaagtgaaacgaca
ccaactccccttgaaaaagcatctgaagaaaccccaataagtcaaattgccgagcaagta
cctttcgtacccacacaaatgaaaacctacgatagtgtaccgagcattacacctatggag
gaaaaacagtcggaatcggaaaaaactgatgctaagtcacttactgccactggcgacgaa
atcattgagatgacgcgtatgggtaaaatgatttccgaacatatgacccgaagcaaacaa
acttcggcgcacgtacaaagctttactgaggtagatgttacccgcatttggaattggcgt
aataaggtcaaaaaagcattcgaaacacgcgagggcgaaaaattcacctttacacctatc
tttatggaagctgttacccaagccctaaaagattatccaatgatgaatatttcggtagaa
gacaccaaaatcatcaaaaagaaaaatattaacattggtatggctacagccctgcccgac
gggaacttgattgttccggtgataaaaaatgccgaccaactcagtctgcgcggtatggca
aaagtagttaacgatttggcaactcgtgctcgtgccggacagctcaaacccgatgaggta
aaagatggcacctacaccgttactaacatcggttcgtttggcaatgtatttggtacgccc
attatcaatcagcctcaagtgggtattttagccataggagctattcgtaaagttcctgca
gtgattgaaacccccgacggcgaccttatcggtatccgatacaaaatgatgctttcgcac
agctacgaccaccgcgtggtaaatggtgccttgggtggtatgtttgtgcaacgtgtagcc
gagtatttagagcattgggacattacccgtgaggtataa

DBGET integrated database retrieval system