KEGG   Capnocytophaga canimorsus: Ccan_07060Help
Entry
Ccan_07060        CDS       T01582                                 

Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
ccm  Capnocytophaga canimorsus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ccan_07060
DNA repair and recombination proteins [BR:ccm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Ccan_07060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(762731..763348)
Genome map
AA seq 205 aa AA seqDB search
MEFSSKLLENAVYEIAQLPGIGKRTALRLALHLLKQPQEQSLRLANALSSLRQQIGYCES
CFNISDTPICPICANHSRNDELICVVEDFRDVMAIENTGQFFGKYHVLGGKISPIDGVGP
LNLNISQLVERVKNGGVKEIIFALSNTMEGDTTNFYIYKQIEKYNIITSTIARGISVGSE
LEYADEITLGRSILQRIPFEHTLKL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggaattctcatcgaaattattagaaaacgccgtttacgaaattgcacaactgcctgga
attgggaaacgtactgccttacgtttggcactacatctactcaaacaaccccaagaacaa
agtctgcgactagcaaatgcactatcctcgttacgtcagcaaattgggtattgcgagtct
tgcttcaatatctccgacacacccatttgcccaatatgtgctaatcacagccgtaatgac
gaactgatttgtgtggtagaagattttcgagatgtaatggctattgaaaatacgggacaa
ttctttggtaaatatcacgtacttggtggaaaaatatcacccatagatggtgtaggtccg
ctcaacttaaacatttctcaattggtagaaagggtaaaaaacgggggcgttaaagaaatc
atctttgcactgagcaacacgatggagggcgacactactaatttttacatctacaagcaa
atcgaaaaatacaacatcatcacctctaccatagcacgtggtatatcggtgggaagtgaa
ctggagtatgccgatgaaatcactttgggtagaagcatcttacagcgtattccctttgaa
cataccctaaaactataa

DBGET integrated database retrieval system