KEGG   Capnocytophaga canimorsus: Ccan_07840Help
Entry
Ccan_07840        CDS       T01582                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ccan_07840
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ccan_07840
   00640 Propanoate metabolism
    Ccan_07840
   00660 C5-Branched dibasic acid metabolism
    Ccan_07840
Enzymes [BR:ccm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ccan_07840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(840817..842034)
Genome map
AA seq 405 aa AA seqDB search
MKLSNQLQMNLHEYQGKEILSSFGVRVQRGIVAQSPKEAVDAAKQLTDETGTQWYVVKAQ
IHAGGRGKGGGVKLAKGLQEVEPIAEQIIGMNLVTPQTPAEGKKVHQVLIAEDVYYPGES
QPAEFYMSVLLDRAKGKNMIMYSTEGGMDIEAVAEKTPHLIFTEEIDPAVGLLPFQARQI
AFNLGLFGEAFKDMVKFVTALYNAYVASDANLFEINPVLKTSDNKILAVDAKVTLDDNAL
YRHKQYAQMRDLREEKPIEVEAKAAGLNYVALDGNVGCMVNGAGLAMATMDLIKQAGGSP
ANFLDVGGTADAKRVETAFRIILKDPKVKAILVNIFGGIVRCDRVAQGIIDAYKNMGAEI
QVPIIVRLQGTNAEIAKEMIDNSGLAVHSAIMFQEAADKVKEVLK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttatcaaatcaattacagatgaatttacacgaatatcaaggaaaagaaatactt
tcaagcttcggagtgcgtgtacaacgcggtatagtggctcaaagcccaaaagaagcagta
gatgcagcaaaacaacttaccgacgaaacaggaacacagtggtatgtagttaaagctcaa
attcacgcaggtggacgtggaaaaggaggcggagtaaagttagccaaagggctacaagag
gttgaacccattgctgagcaaattatcggaatgaatttggtaacccctcaaactcctgcc
gaagggaaaaaagtacaccaagtacttatcgctgaagatgtttactatcctggtgagagc
caacctgccgaattctatatgtcggtgttactggacagagctaaaggtaaaaatatgatt
atgtactccaccgaaggagggatggacattgaagcggtagctgaaaaaacgccacatctt
atttttacagaggaaattgaccctgccgttggattattacctttccaagccagacaaata
gcattcaatttagggctttttggtgaagcgttcaaagatatggttaaatttgtgactgcc
ttatacaatgcttatgttgcctctgacgctaatcttttcgaaatcaaccctgtactaaaa
acgtccgataataaaattttagctgtagacgccaaagttactttggacgataacgcgctt
tatcgccataaacaatatgcccaaatgcgtgatttacgtgaggaaaaacctatagaggta
gaagccaaagcagcaggacttaactatgtagctttagatggcaacgtaggatgtatggtt
aacggagctgggctggctatggcaactatggatttgattaaacaagcgggaggttcaccc
gccaactttttggacgtagggggtactgctgacgccaaacgcgtggaaaccgctttccga
atcattctgaaagacccaaaagtaaaagccattttggtaaacatttttggtggaattgtt
cgttgcgacagagtagcccaaggtattattgatgcttacaaaaatatgggggcagagatt
caagtacctattatcgtaaggctacaaggtaccaatgccgaaattgctaaagaaatgata
gacaactcaggattagcagtacactcagcaattatgttccaagaagctgctgacaaagtg
aaagaagttttaaaataa

DBGET integrated database retrieval system