KEGG   Capnocytophaga canimorsus: Ccan_08620Help
Entry
Ccan_08620        CDS       T01582                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ccan_08620
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccan_08620
Enzymes [BR:ccm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ccan_08620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
923216..924004
Genome map
AA seq 262 aa AA seqDB search
MTLLDRLLVHKFEEVALKKSLIPISAFEQNPIFHTSSRSFTAFLNNNSYGIFGGFYRRSP
WQTEINPHLNVFEVAQAYEKGGFAGISICTDTKYFGGSLDDMLLVKASCQLPVLCNDFIV
DVYQIYESKAHAADAVLLMASILKLDQIQYLTQEAHRIGLEVFLQINDMQDIEKCLLCPF
DVLVVSSRCFSTSEVDFKKYNYFYDKLSEVPLKIAEGGIFNTKQILDLKRIGYTGCMVDF
PFLQSDAVFYSVNTFISNLSSN
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacacttttagaccgattattagtccataaatttgaagaagtagccttgaaaaaaagc
ctaataccgatatctgcttttgagcaaaatcctatatttcatacttcaagtcgttctttt
acagcatttttgaataataattcttacggaatttttggcggattttatcgtaggtcgcct
tggcaaacagaaataaatccgcatttgaatgtttttgaggtagctcaagcctatgaaaaa
ggaggatttgcaggaatttcaatatgtaccgatacaaagtattttggaggctcacttgat
gatatgttattggtaaaagcctcttgtcaacttcctgtactttgtaatgattttatagta
gatgtatatcaaatttatgaaagtaaggctcacgcagctgatgctgtactgcttatggct
tcaattttaaagttggatcaaattcagtatttgactcaagaagctcatcgcataggcttg
gaagtatttttacagataaatgatatgcaagatattgaaaaatgcttgttatgtccgttt
gatgttttggtggtaagtagtcgttgtttttctacttcagaagttgattttaaaaaatat
aattatttttacgacaaactctctgaggttcctttaaaaattgcagaaggtggaattttt
aacacaaaacaaatacttgatttaaagcggattggatatacgggttgtatggtagatttt
ccttttttacaatcggatgccgttttttatagtgtgaatacttttattagcaacctttca
tcaaattaa

DBGET integrated database retrieval system