KEGG   Capnocytophaga canimorsus: Ccan_09220Help
Entry
Ccan_09220        CDS       T01582                                 

Definition
histidine ammonia-lyase (EC:4.3.1.3)
Orthology
K01745  
histidine ammonia-lyase [EC:4.3.1.3]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Histidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Ccan_09220
Enzymes [BR:ccm01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.3  histidine ammonia-lyase
     Ccan_09220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
986088..987554
Genome map
AA seq 488 aa AA seqDB search
MIHYISNETLNLERLEVIISEGVKLKLSEEAVVNIEKSYTYLQNRLKNATNPIENVVSAS
CFDSNGKILPQKISENQHNLLKSYACGFGRTAPDTIVKLMLFLKIQSLSYGYSGVHLKTV
ERLIDFFNNDILPVVYLEGAPDDRISLANMALPLIGEGEVRINGKVFSACELEAQYGWQP
LRLGPKEGEALLVGTQLTTAYAVYCLIKSLKICVLSDFIASLSADVFGADASPFLAEVQA
VRPHKGQILTAKNLRAFLSNNEKKEQYVPEAFYAIPQVHGAVKDAIAAVRKVIRTEINSA
TDNTLIFQELNAIFYGGNSHTLPLSFALDYLAIALTGLGNISERRTFHLINKTEHLPNKK
TLDFWVLQRMGEGISVENKHLAVPTSAENPMLIEKRFDIKGMGGSAAVKCYQLVENIQQL
LAIELLTAMLFLENQFDENDVKRVILQDFRNDLKINKKSFSLKKSLEKTIRFLENFDFSH
QIFQNSKI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgattcactatatatccaatgaaaccttaaacttagagcgacttgaggttattatttca
gagggcgttaagctcaaactttctgaagaagcagtggttaacattgaaaaaagttacact
tatttacaaaacagattaaaaaacgcaacaaacccgattgagaatgttgttagcgcttct
tgttttgactcaaacgggaaaatacttcctcaaaaaatatcagaaaaccaacacaatttg
ctaaaatcatacgcttgtgggtttggtcgtactgctcctgatactatcgtaaaattgatg
ttgtttttgaagatacaatcgcttagttatggttacagtggggtgcatttgaaaacggtg
gaacgacttattgattttttcaataacgatattttacctgtggtgtatctggaaggtgct
cctgatgatcgtatctctttggcaaatatggctttacctttaatcggagaaggagaagta
cgtataaatggtaaagttttttcggcttgtgaattggaagctcaatacggttggcaacct
cttcgattggggcctaaagaaggcgaagcccttttggtaggaacacaattaacgacggct
tatgcggtttattgtttgattaaatcgttgaaaatatgtgtattgtccgattttattgct
tctttatctgctgatgtatttggtgctgacgcaagtccttttttagctgaagttcaggca
gttcgtccgcataaaggacaaattttaacggcaaaaaatcttagagcatttttaagtaat
aatgagaaaaaagaacaatacgttcccgaggctttttatgctattcctcaggttcacggt
gccgttaaagatgccattgccgcggtgcgtaaggtaattcgtactgaaatcaattcagct
actgataacacccttatttttcaagagcttaacgctattttttacggcggaaattcacac
accttacctttatcatttgctttggattacttagccattgcacttactggattaggaaac
atatccgaaagacgtacttttcatctgataaacaaaacggaacatttacccaacaaaaaa
acgctcgatttttgggttttacagcgtatgggagaggggatttctgtagaaaacaagcat
ttggctgtccctacaagtgctgaaaatccaatgcttattgaaaaaagattcgatatcaaa
ggtatgggtggcagtgctgcagtaaagtgttatcaattggttgaaaatatacagcagctc
ttagctattgaactacttacggcaatgcttttccttgaaaatcaatttgatgaaaacgat
gtgaaacgagtaattttacaagattttagaaatgatttaaaaatcaataaaaaaagtttt
tcacttaaaaagagccttgaaaagacaatacgttttttagagaactttgatttttctcat
caaattttccaaaactctaaaatttaa

DBGET integrated database retrieval system