KEGG   Capnocytophaga canimorsus: Ccan_09220Help
Entry
Ccan_09220        CDS       T01582                                 

Definition
histidine ammonia-lyase (EC:4.3.1.3)
Orthology
K01745  
histidine ammonia-lyase [EC:4.3.1.3]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Histidine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ccm00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
986088..987554
Genome map
AA seq 488 aa AA seqDB search
MIHYISNETLNLERLEVIISEGVKLKLSEEAVVNIEKSYTYLQNRLKNATNPIENVVSAS
CFDSNGKILPQKISENQHNLLKSYACGFGRTAPDTIVKLMLFLKIQSLSYGYSGVHLKTV
ERLIDFFNNDILPVVYLEGAPDDRISLANMALPLIGEGEVRINGKVFSACELEAQYGWQP
LRLGPKEGEALLVGTQLTTAYAVYCLIKSLKICVLSDFIASLSADVFGADASPFLAEVQA
VRPHKGQILTAKNLRAFLSNNEKKEQYVPEAFYAIPQVHGAVKDAIAAVRKVIRTEINSA
TDNTLIFQELNAIFYGGNSHTLPLSFALDYLAIALTGLGNISERRTFHLINKTEHLPNKK
TLDFWVLQRMGEGISVENKHLAVPTSAENPMLIEKRFDIKGMGGSAAVKCYQLVENIQQL
LAIELLTAMLFLENQFDENDVKRVILQDFRNDLKINKKSFSLKKSLEKTIRFLENFDFSH
QIFQNSKI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgattcactatatatccaatgaaaccttaaacttagagcgacttgaggttattatttca
gagggcgttaagctcaaactttctgaagaagcagtggttaacattgaaaaaagttacact
tatttacaaaacagattaaaaaacgcaacaaacccgattgagaatgttgttagcgcttct
tgttttgactcaaacgggaaaatacttcctcaaaaaatatcagaaaaccaacacaatttg
ctaaaatcatacgcttgtgggtttggtcgtactgctcctgatactatcgtaaaattgatg
ttgtttttgaagatacaatcgcttagttatggttacagtggggtgcatttgaaaacggtg
gaacgacttattgattttttcaataacgatattttacctgtggtgtatctggaaggtgct
cctgatgatcgtatctctttggcaaatatggctttacctttaatcggagaaggagaagta
cgtataaatggtaaagttttttcggcttgtgaattggaagctcaatacggttggcaacct
cttcgattggggcctaaagaaggcgaagcccttttggtaggaacacaattaacgacggct
tatgcggtttattgtttgattaaatcgttgaaaatatgtgtattgtccgattttattgct
tctttatctgctgatgtatttggtgctgacgcaagtccttttttagctgaagttcaggca
gttcgtccgcataaaggacaaattttaacggcaaaaaatcttagagcatttttaagtaat
aatgagaaaaaagaacaatacgttcccgaggctttttatgctattcctcaggttcacggt
gccgttaaagatgccattgccgcggtgcgtaaggtaattcgtactgaaatcaattcagct
actgataacacccttatttttcaagagcttaacgctattttttacggcggaaattcacac
accttacctttatcatttgctttggattacttagccattgcacttactggattaggaaac
atatccgaaagacgtacttttcatctgataaacaaaacggaacatttacccaacaaaaaa
acgctcgatttttgggttttacagcgtatgggagaggggatttctgtagaaaacaagcat
ttggctgtccctacaagtgctgaaaatccaatgcttattgaaaaaagattcgatatcaaa
ggtatgggtggcagtgctgcagtaaagtgttatcaattggttgaaaatatacagcagctc
ttagctattgaactacttacggcaatgcttttccttgaaaatcaatttgatgaaaacgat
gtgaaacgagtaattttacaagattttagaaatgatttaaaaatcaataaaaaaagtttt
tcacttaaaaagagccttgaaaagacaatacgttttttagagaactttgatttttctcat
caaattttccaaaactctaaaatttaa

DBGET integrated database retrieval system