KEGG   Capnocytophaga canimorsus: Ccan_10230Help
Entry
Ccan_10230        CDS       T01582                                 

Definition
phosphohexokinase 2 (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ccan_10230
   01230 Biosynthesis of amino acids
    Ccan_10230
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ccan_10230
   00030 Pentose phosphate pathway
    Ccan_10230
   00051 Fructose and mannose metabolism
    Ccan_10230
   00052 Galactose metabolism
    Ccan_10230
  Energy metabolism
   00680 Methane metabolism
    Ccan_10230
Enzymes [BR:ccm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ccan_10230
Protein phosphatases and associated proteins [BR:ccm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ccan_10230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1096417..1097406)
Genome map
AA seq 329 aa AA seqDB search
MSEKKIKKIAVLTSGGDAPGMNAAIRAVVRTCAYHNVAVLGVYRGYQGMIEEDFIELNAR
SVRDTINKGGTFLKSARSKDFRTKEGRQKAYENLKKHNVDALVVIGGDGSFTGALLFNEE
HNFPVMGIPGTIDNDIYGTSHTLGYDTALNTAVEAIDKIRDTASSHNRMFFIEVMGRDAG
FIALNTGIGGGAERILIPEEDTPIEELLQDIEEGHAKGKTSNIIVVAEGDKTGKNIFELK
EYVEKKHPEYDIRVAILGHMQRGGAPSCYDRVLASRMGVKAVETLLEGKSNYMVGINNDV
IDLTPLEKAIKGGSKLDMELVRVAEIMSI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaaaaagattaagaaaatagcagttttaacctctggtggtgatgctccagga
atgaacgctgccatccgtgcggtggttcgtacgtgtgcgtatcacaatgttgccgttttg
ggggtgtatcgtggttatcaaggaatgattgaagaggattttatagaattgaatgctcgt
agcgttcgtgataccatcaataaaggaggaacttttttgaaatcagcacgttctaaggat
ttccgaactaaagaaggtcgccaaaaagcttacgaaaatcttaaaaaacacaatgtagat
gccttggtagtcatcggtggagatggttcatttacaggggctttgcttttcaatgaagag
cacaattttccagtgatgggaattcctggaactattgataacgatatttatggaacaagc
catactttaggttacgataccgcacttaatacggcagtagaagctattgacaaaatccgc
gacacagcaagttctcacaaccgaatgtttttcattgaggttatggggcgtgacgctgga
tttatcgcactaaatacgggtattggtggtggtgctgaacgaattttaattccagaggaa
gatacacctattgaagaacttttgcaagatattgaggaaggtcacgccaaaggaaaaact
tctaacatcatcgtggttgctgaaggagataaaacgggtaaaaatatttttgaattaaaa
gaatatgttgagaaaaaacacccagagtacgacattcgtgtggccattttaggacatatg
caacgtggtggagctccttcttgttatgatcgtgttcttgccagtcgtatgggagtgaaa
gcggtagaaacacttttagaaggaaaatcgaactatatggtaggaatcaataatgatgta
attgacttgactccgctcgaaaaagctatcaaaggaggaagcaagttggatatggaactt
gttcgcgtagcagagattatgagtatttag

DBGET integrated database retrieval system