KEGG   Capnocytophaga canimorsus: Ccan_10780Help
Entry
Ccan_10780        CDS       T01582                                 

Definition
L-isoaspartyl protein carboxyl methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ccm  Capnocytophaga canimorsus
Brite
Enzymes [BR:ccm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Ccan_10780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1148204..1148818
Genome map
AA seq 204 aa AA seqDB search
MRNQLAENLAKKGITDTLVLEAIKAVPRHLFIDSSFETHAYEDKAFPIGAEQTISHPSTV
AFQTQLLQVKSGQKVLEIGTGSGYQSSVLLFLGVKLFTIERQFELFKQAKLLIPKLINRP
LKMYFGDGYAGLPQEAPFDRILVTAGAPQVPQALLAQLAVGGRMVIPIGKNTQTMTLFER
ISEKEFHKSEYGEFQFVPLLKNRN
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatcaacttgccgaaaatttggcaaaaaaaggcataactgacactttagttttg
gaagccataaaggcagtgccaagacatttgtttattgatagtagttttgaaactcacgcc
tatgaggataaagctttccccattggggcagagcaaaccatttcgcatccgtcaacagta
gcttttcaaacccaacttttgcaagtcaaatctgggcaaaaggtactcgaaataggcact
ggaagtggttatcaatcaagtgttttattatttttaggagtgaaattatttaccattgaa
aggcaatttgagcttttcaaacaagcaaagctacttattcctaaacttatcaatcgtcct
ttaaagatgtactttggtgatgggtatgcagggcttcctcaagaagctcctttcgataga
attttggttacggcaggtgctccgcaggtgcctcaagccttacttgctcaacttgctgtg
ggaggacgaatggtaatccccatagggaaaaacacgcaaacaatgacgctgtttgagcgt
atttccgaaaaagaatttcataaaagtgaatatggtgaattccagtttgttcctttacta
aaaaatagaaattaa

DBGET integrated database retrieval system