KEGG   Capnocytophaga canimorsus: Ccan_13300Help
Entry
Ccan_13300        CDS       T01582                                 

Definition
UDP-N-acetylglucosamine enolpyruvyl transferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ccm00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ccm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1416252..1417562
Genome map
AA seq 436 aa AA seqDB search
MGVFKIEGGHTLKGEITPQGAKNEALQILCAVLLTDQKVTIHNIPDILDVNKLIVLLGNL
GVKIQKLGKGSYSFQADEVNLDYLRTDSFRVEGQSLRGSIMIIGPLLTRFGIGYMPKPGG
DKIGRRRLDTHFEGFIKLGADFRYDKEQHAYSVKAEKLKGTYMLLDEASVTGTSNIIMAA
VLAQGVTTIYNAACEPYIQQLCKMLISMGAKIEGIGSNLLTIEGVEQLQGCTHTILPDMV
EIGSWIGLAAMTQSELTIKDVAWEYLGQIPNVFRKLGITLEKKGDDIYIPAHTQGYKIQK
DIDGSILTIADAPWPGFTPDLLSIVLVVATQAQGEVLIHQKMFESRLFFVDKLIDMGAKI
ILCDPHRATVIGHAFKSSLKATVMTSPDIRAGIALLIAALSAKGTSTIYNIEQIDRGYEQ
IDERLRAIGANIIRVQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtttttaaaattgaaggggggcacacgcttaaaggcgaaattactccacaaggc
gctaaaaatgaggctctacaaattctttgtgccgttttactaaccgaccaaaaagtaacc
atacataacattcctgacattttggatgttaataaactcattgtgttactgggtaatttg
ggggtaaaaatacaaaaactgggcaaaggttcgtatagttttcaagcagatgaagtcaat
ttggattacttaagaaccgattcttttcgagttgaaggacaaagcctaagaggttcaatt
atgattataggaccgcttttaacacgcttcgggataggatatatgcctaaacctggcgga
gataaaatcggacgtcgccgattggatactcattttgaaggttttatcaaattaggtgca
gatttccgctacgataaggagcaacacgcttatagtgtaaaggctgaaaaactcaaaggt
acatatatgttgcttgatgaggcttccgttactggtacttctaatatcattatggctgcc
gttcttgcccaaggggtaacaaccatttacaatgccgcgtgtgagccttatattcagcaa
ctttgtaaaatgcttatcagtatgggagctaaaattgagggaattggctctaatttgctt
accattgaaggtgtggagcaattgcagggttgtacgcataccatacttccagatatggtg
gaaatcggcagttggattggattggctgcaatgacacaaagcgaattaaccattaaagac
gtagcttgggaatatttggggcaaatccccaatgtgttccgaaaattaggaatcactctt
gaaaaaaaaggcgatgatatatatattccagctcatacccaaggttataaaatacaaaaa
gacattgatggttctattttaaccattgccgatgcaccttggcctggttttacccccgat
ttgcttagtatcgtactggtagttgctacacaagcacaaggtgaagtactcatccatcaa
aaaatgtttgagagtcgcctctttttcgtagataaactcattgatatgggagcaaaaatc
attttgtgcgacccgcatcgggctacggtaatcggacacgcctttaaatcgtcgctcaag
gctacagtgatgacctcacccgatattcgtgcagggattgccctactcattgctgcatta
tcggcaaagggaacttctactatttataatatagaacaaatagacagaggctatgagcaa
atagatgaacgtttaagagcaatcggagcaaatatcattcgtgttcagtag

DBGET integrated database retrieval system