KEGG   Capnocytophaga canimorsus: Ccan_13530Help
Entry
Ccan_13530        CDS       T01582                                 

Definition
Tryptophan synthase beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ccan_13530
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ccan_13530
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccan_13530
Enzymes [BR:ccm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ccan_13530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1441446..1442654
Genome map
AA seq 402 aa AA seqDB search
MKSITAKNNETAIEVAPLNEMLNYQGHYGAYGGAYVPPALETQLKKLSDFFDTIAPTTSF
QEEYISILKDFIGRPSALYLAKNLSAYVGAKIYLKREDLNHTGSHKINNAVGQILLAQKM
GAKEIIAETGAGQHGVATATACAFLGLPCKIFMGAVDMQRQALNVKRMQLLGAEVIACAS
GNQTLKDAVDTALSYYIENPESYYLLGSHVGPHPYPKMVGFFQSVIGNEAKQQFLQKEGK
LPDSIIACLGGGSNAIGLFSAFLEDQEVKIYGAEGGGEDTLNSTAATLNYGTPIVFQGTY
SYCLTDENGNPIASKSVAAGLDYPGISPQHAHLKDIKRVEYHSVTDKQAIEAYQLLSRLE
GITPAIESSHAVALAIKLMKDTNQTVIVNLSGRGDKDVERDM
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaataaccgcaaaaaacaatgaaacagccattgaggtagcccctttaaatgaa
atgcttaattatcaaggacattatggagcttatggtggagcttacgtacctcctgcattg
gaaacacaacttaaaaaattaagcgatttttttgatactatcgcccctacaacaagtttc
caagaggaatatatcagtattttaaaagattttatcggcagaccctcagcactttatttg
gctaaaaatttaagtgcctatgttggggctaaaatctacctcaaacgcgaagatttaaac
catacaggctcacataagataaataatgctgtaggacagatacttttagcacaaaaaatg
ggtgctaaagaaattattgccgaaactggggctgggcaacacggcgtagctaccgctaca
gcttgtgcgtttttagggctaccctgtaaaatctttatgggggctgttgatatgcaacgc
caagccttaaatgtgaaaagaatgcaactactaggagctgaagtaattgcttgtgcttca
ggaaatcaaaccctaaaagatgccgtagatactgcattgagctactatattgaaaatcca
gaaagttactacttattagggtctcacgtaggtccgcatccgtatccgaaaatggtaggt
tttttccaaagtgttataggtaatgaagccaaacaacaatttttacaaaaggaaggaaaa
ctccccgatagtattattgcttgtttgggcggagggtcaaacgctatcgggcttttttca
gctttcttagaagaccaagaagttaagatatacggggctgaaggaggcggtgaagatact
ctaaatagcacagcagctactttaaattacggaactccgattgtttttcaaggaacatat
tcgtattgtttaacggacgaaaatggcaatccgatagcttcaaaatcggtagctgctggg
ttggattaccctggaataagtccgcaacacgctcatttaaaagacattaaacgtgtagaa
tatcattctgttactgataagcaagccattgaggcttaccaactactttctcgtttagag
gggattacccctgccatagagtcctctcacgctgtggctttagccataaaactgatgaaa
gacacaaatcaaactgtaattgttaacctatcaggaagaggtgacaaagatgtagaaaga
gatatgtaa

DBGET integrated database retrieval system