KEGG   Capnocytophaga canimorsus: Ccan_13530Help
Entry
Ccan_13530        CDS       T01582                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ccan_13530
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ccan_13530
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccan_13530
Enzymes [BR:ccm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ccan_13530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1441446..1442654
Genome map
AA seq 402 aa AA seqDB search
MKSITAKNNETAIEVAPLNEMLNYQGHYGAYGGAYVPPALETQLKKLSDFFDTIAPTTSF
QEEYISILKDFIGRPSALYLAKNLSAYVGAKIYLKREDLNHTGSHKINNAVGQILLAQKM
GAKEIIAETGAGQHGVATATACAFLGLPCKIFMGAVDMQRQALNVKRMQLLGAEVIACAS
GNQTLKDAVDTALSYYIENPESYYLLGSHVGPHPYPKMVGFFQSVIGNEAKQQFLQKEGK
LPDSIIACLGGGSNAIGLFSAFLEDQEVKIYGAEGGGEDTLNSTAATLNYGTPIVFQGTY
SYCLTDENGNPIASKSVAAGLDYPGISPQHAHLKDIKRVEYHSVTDKQAIEAYQLLSRLE
GITPAIESSHAVALAIKLMKDTNQTVIVNLSGRGDKDVERDM
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaataaccgcaaaaaacaatgaaacagccattgaggtagcccctttaaatgaa
atgcttaattatcaaggacattatggagcttatggtggagcttacgtacctcctgcattg
gaaacacaacttaaaaaattaagcgatttttttgatactatcgcccctacaacaagtttc
caagaggaatatatcagtattttaaaagattttatcggcagaccctcagcactttatttg
gctaaaaatttaagtgcctatgttggggctaaaatctacctcaaacgcgaagatttaaac
catacaggctcacataagataaataatgctgtaggacagatacttttagcacaaaaaatg
ggtgctaaagaaattattgccgaaactggggctgggcaacacggcgtagctaccgctaca
gcttgtgcgtttttagggctaccctgtaaaatctttatgggggctgttgatatgcaacgc
caagccttaaatgtgaaaagaatgcaactactaggagctgaagtaattgcttgtgcttca
ggaaatcaaaccctaaaagatgccgtagatactgcattgagctactatattgaaaatcca
gaaagttactacttattagggtctcacgtaggtccgcatccgtatccgaaaatggtaggt
tttttccaaagtgttataggtaatgaagccaaacaacaatttttacaaaaggaaggaaaa
ctccccgatagtattattgcttgtttgggcggagggtcaaacgctatcgggcttttttca
gctttcttagaagaccaagaagttaagatatacggggctgaaggaggcggtgaagatact
ctaaatagcacagcagctactttaaattacggaactccgattgtttttcaaggaacatat
tcgtattgtttaacggacgaaaatggcaatccgatagcttcaaaatcggtagctgctggg
ttggattaccctggaataagtccgcaacacgctcatttaaaagacattaaacgtgtagaa
tatcattctgttactgataagcaagccattgaggcttaccaactactttctcgtttagag
gggattacccctgccatagagtcctctcacgctgtggctttagccataaaactgatgaaa
gacacaaatcaaactgtaattgttaacctatcaggaagaggtgacaaagatgtagaaaga
gatatgtaa

DBGET integrated database retrieval system