KEGG   Capnocytophaga canimorsus: Ccan_14050Help
Entry
Ccan_14050        CDS       T01582                                 

Definition
glucan endo-1,6-beta-glucosidase BGN163 (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ccm00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ccm00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1502652..1504100
Genome map
AA seq 482 aa AA seqDB search
MNVKITTILISFWIIISCSNNKLESRKVAVLITTANGEKSFHKEEINLVMNDAQTKADIT
LNPSEKYQSVYGFGSAITGSTCYNLLKMNPSDRTTFLKETFSTTEGLGQSYVRISIGCSD
FSMSEYTLCDKEGIENFALQSEEKEYVIPILKEILTINPDVKIIGSPWTPPRWMKVNNLK
DLKPHYEWTSGHLNPKHYDDYALYFVKWLQAMKSQGIEVDAITIQNEPLNRGNSASLFMG
WQEQLDFIKKSLGKRFKQEGITTKIYLFDHNFNYDNMADQKDYPLHIYNDKQASSYIAGA
AYHNYGGHYDELQKIHLAQPDKELIFTETSIGEWNDGRNLSARLLDDMEHIGIGILNNWG
KAVIVWNLMLDEKGAPNREGGCKTCYGAVDISSSDYKTITKNSHYYVIGHLASVIKPNAI
RIQSETSKKNILCTSFKNPDGSYALVLLNRASSDEEITINDGKKHFKYSIPARSVASFLW
NN
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaaaaatcacaaccatattgattagtttttggataattatttcttgctctaac
aataagttagaaagtagaaaggtagcggttttaatcaccacagcgaatggcgaaaaaagt
tttcataaggaagaaatcaatttggtgatgaatgatgcccaaacaaaggctgatattacg
ctaaatccttccgaaaagtatcagtctgtctacggatttgggtcagcgataacagggtca
acttgttacaatctactgaaaatgaatccttccgacagaactactttcttaaaagaaaca
ttctcaactactgaaggtttagggcaaagttatgtacgaatttctatcggttgctccgat
ttttcgatgagtgaatacaccctttgcgacaaagaaggaattgaaaatttcgctttacaa
tccgaagaaaaagaatatgtaatccctattctgaaagaaattttaaccataaatcctgat
gtgaaaatcatcggttcgccttggacgccaccacgttggatgaaagtaaacaacctgaag
gatttaaaaccgcattatgagtggactagcggtcacctcaacccaaaacactatgatgat
tacgcattatatttcgtaaaatggcttcaagcaatgaaaagtcaaggcattgaagttgat
gcaattacgattcagaatgaaccacttaacagaggaaattctgcttcgctgtttatgggt
tggcaagaacagttagatttcataaaaaaatcgttagggaaacgtttcaaacaagaagga
atcacgaccaaaatttacctgttcgaccataacttcaactacgacaatatggcagaccag
aaggattatccgctccacatttataacgacaagcaagcatcgagttacattgcaggagct
gcctatcacaattatggagggcattacgatgaacttcaaaaaatacatttagcacaaccc
gataaagaacttattttcaccgaaacttctattggagaatggaacgatggacgaaattta
tcagctcgtttgttagatgatatggagcatattggcatcggaattctcaataattgggga
aaagccgttattgtctggaatttgatgctcgacgaaaaaggtgctcccaatcgggaagga
ggttgcaaaacttgctacggagcggttgatatttcatcaagcgattacaaaaccatcact
aaaaactcacattattacgttattgggcatttggcatcggtgataaaacccaatgccatt
cgtattcaatcggaaactagtaaaaaaaatattttgtgtacaagcttcaaaaatcctgac
ggaagttacgctttagtacttctaaatagagcttcttccgatgaagaaattacaataaat
gacggcaaaaaacattttaaatatagtattccagcacgtagtgtagcatcttttttatgg
aataattaa

DBGET integrated database retrieval system