KEGG   Capnocytophaga canimorsus: Ccan_14980Help
Entry
Ccan_14980        CDS       T01582                                 

Definition
(GenBank) Agmatine ureohydrolase 1
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
ccm  Capnocytophaga canimorsus
Pathway
ccm00330  Arginine and proline metabolism
ccm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Ccan_14980
Enzymes [BR:ccm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Ccan_14980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: AEK23614
UniProt: F9YR04
Position
complement(1616029..1616736)
Genome map
AA seq 235 aa AA seqDB search
MELYDIETDTEPYLEGVYLAGEVSENASPEAMTEAVYQKTKELLKNEGKLFTLFGGEHSV
SIGAIRAVGEKYDNLTVLQLDAHTDLRSDFHGSACNHACAVFEANQKHNLVQVGIRSMDA
EEKQYLPEGRVFFAHQIAKNPNWIDEVLAKVSGNVYITIDLDAFDPAFAPSTGTPEPGGL
QWYPTLELLHKVFKKCNVVAFDIVELMDSPAAKPTAFLAAKLYYKMLAYYHTAKK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggaactttatgatatagaaactgatacggagccctatttagaaggtgtttatttggca
ggagaggtttcagaaaatgcttcacctgaggcaatgacagaagcagtttatcagaaaacc
aaagaattgcttaaaaatgaaggaaaactatttactctctttggaggagagcactcggta
tcaataggtgctattcgtgcggtgggcgaaaaatatgataatctgaccgttttacagtta
gatgctcatacggatttgcgttctgattttcacggctcggcttgtaaccacgcttgtgcg
gtttttgaagccaaccaaaagcataatttggtgcaggtaggtatccgctctatggatgct
gaagaaaaacaatatttgccagaaggtcgtgttttctttgcgcatcaaatagctaaaaat
ccgaattggatagatgaggtattggctaaggtttcaggtaatgtatacataaccattgat
ttagatgcttttgaccctgcctttgcgccttctacaggaacccctgaaccaggcggattg
caatggtatcctactttggaactattacataaggtatttaaaaaatgtaatgtggtagcc
tttgatattgtggaacttatggatagccctgcggctaagccaacagcctttttagcggct
aaactttattacaaaatgttagcttattatcatactgctaaaaaatag

DBGET integrated database retrieval system