KEGG   Capnocytophaga canimorsus: Ccan_15370Help
Entry
Ccan_15370        CDS       T01582                                 

Definition
alkaline phosphatase IV (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ccan_15370
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Ccan_15370
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ccan_15370
Enzymes [BR:ccm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Ccan_15370
Exosome [BR:ccm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ccan_15370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1655856..1657259
Genome map
AA seq 467 aa AA seqDB search
MKRRQFFKKSALAGMGSLFVPTFAKAEIVEEFGGKTPKNIIYMVSDGMSSGTLTMADLYS
RRILGKPSNWISLYEQSLATKAYMDMQSLSSVVTDSAAASSSWGGGHRVPNGRLNVGPNG
EMYTPIWQKFKKAGKKVGCVTTVPITHATPAGFCVNSKARNAQEDIAEQYLQLRFDVMMG
GGDKYFSSQKRKDKKDMYQQFVRGGFTVVKNKTDMKKAPKNKPLLGVFDEEGLPYSLDYT
SEKDLQQCPTLAEMTAKAIEQMQDHSKGFVLQVEGGKVDWAAHGNDIGALLFDQLAFDQA
VGVALQFAQKDKNTLVVVTTDHGNANPGLIYGQHCNTNFDNLQHFRHSNDWVLQNIDPNS
SAKFIKEIVAEHFGGLQLTQAQSEEIQSYYVNHGREDGVYNYKHLPYRLLAEIQKSHTSV
GWISMDHSSDYVELAMYGPGSENLKPFMKNYEMHNFLLEVANVGMLA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaagacagtttttcaaaaagtcagccttagcaggaatgggttctttgtttgtc
ccaacatttgctaaggcagaaatcgtggaagaattcggtggaaaaacgccgaagaacatc
atctatatggtaagcgatggaatgagcagtggaacactgactatggcagacttatacagc
agacgtattttaggaaaaccttcaaattggataagtctatatgaacaaagtttggcaacc
aaagcctatatggatatgcaatcgttaagttctgtagttacggattctgccgcagcaagt
tcgtcttggggcggtggacatcgtgtacccaacggaaggcttaacgtgggccctaacgga
gagatgtacacccccatttggcaaaagtttaaaaaagcaggtaagaaggtaggttgtgta
actactgtaccgataactcacgcaactccagcaggtttctgcgtgaatagcaaagctaga
aatgcacaagaagatattgccgagcaatacctacaactccgctttgacgtgatgatggga
ggaggagataaatatttttcttcacaaaaaagaaaagacaaaaaagatatgtatcaacaa
tttgtccgtggaggatttaccgtagtaaaaaacaaaacagatatgaaaaaggcacccaaa
aacaaacctctattaggtgtttttgatgaagaaggattgccttattcacttgattatact
tcagaaaaagaccttcaacaatgtcctaccttagctgaaatgacggcaaaagccatcgaa
caaatgcaagaccactcaaaaggttttgtacttcaagtagaaggtggaaaagtagattgg
gcagctcacggaaatgacattggggcattactttttgaccagttagccttcgatcaagcc
gttggtgtggctttacaattcgctcaaaaagataaaaacacacttgttgtggttaccaca
gaccacggaaatgcaaaccccggattgatatacggacaacattgtaacactaatttcgat
aatctgcaacattttagacattcgaacgattgggttttgcaaaatatcgacccgaacagt
tctgcaaaattcataaaagaaattgtagcagaacattttggcggacttcaactcactcaa
gcgcaatctgaagaaatacaatcctactacgtaaaccacggcagagaagacggggtgtat
aattacaaacacctcccctatcgtttacttgctgaaattcagaagtcgcacacttcagta
ggttggattagtatggatcactcttcagactacgtggaattggcaatgtacggaccagga
agtgaaaacttaaaaccttttatgaaaaactacgagatgcacaactttctgttagaagta
gcaaatgtaggaatgttagcataa

DBGET integrated database retrieval system