KEGG   Capnocytophaga canimorsus: Ccan_16650Help
Entry
Ccan_16650        CDS       T01582                                 

Definition
dihydropteroate pyrophosphorylase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ccm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1795197..1796021
Genome map
AA seq 274 aa AA seqDB search
MTINCHGELLDLTSAKIMGIINITPDSFYENSRASSKDLLKKAENMLKQGADLLDIGGYS
SRPGATEVSQEEELRRVVPVVKTLVKTFPKVRISVDTFRSEVARQSLSEGACMINDISAG
HLDEKMWQIIADFQVPYIAMHMKGTPKNMQEHTHYEDIVKEMIFYFSQIKAKAQQYGIND
LIIDPGFGFSKTLEQNYEILRKLSLFRILDVPILVGVSRKSMLYRLLQTTAENALNATTI
VNTLALTKGAHILRVHDVQQAKECVQIFEKMEKL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgactataaactgccacggcgaacttttggatttaacttctgcaaaaattatgggaatt
atcaatatcacccctgattctttctatgaaaatagcagagcttcttccaaagatctcctt
aaaaaagccgaaaatatgcttaaacaaggagctgatttattagatattggaggatatagt
tcacgccctggtgctactgaagtttctcaggaagaagaattaaggcgagtagttcctgtg
gtaaaaacattggtaaaaacttttccgaaggttcgtatttcggtggatactttccgaagt
gaagtagcacgtcagtctctttcagagggagcttgtatgataaatgatatttctgcggga
catcttgatgagaaaatgtggcagattattgctgattttcaagtgccttatattgcaatg
catatgaaaggaaccccaaaaaatatgcaagaacacactcattatgaagacattgtaaag
gaaatgattttctacttttcacaaattaaagccaaagctcaacaatatgggattaatgat
ttaattatagaccctggttttggtttttcaaaaacgttggagcaaaattatgaaatcttg
cgtaagttatccctttttagaattttagacgttcccattttagtaggagtttcacgaaaa
tcaatgctgtatcgtttactacaaaccactgctgagaatgctctcaatgccaccaccata
gtaaatacacttgccttaacaaaaggggcacacattttacgcgtacacgatgtgcaacaa
gccaaagaatgtgtacaaatttttgaaaaaatggaaaaactatga

DBGET integrated database retrieval system