KEGG   Capnocytophaga canimorsus: Ccan_17890Help
Entry
Ccan_17890        CDS       T01582                                 

Definition
phosphatidylcholine 1-acylhydrolase (EC:3.1.1.32 3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ccan_17890
   00565 Ether lipid metabolism
    Ccan_17890
   00590 Arachidonic acid metabolism
    Ccan_17890
   00591 Linoleic acid metabolism
    Ccan_17890
   00592 alpha-Linolenic acid metabolism
    Ccan_17890
Enzymes [BR:ccm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Ccan_17890
    3.1.1.32  phospholipase A1
     Ccan_17890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1941773..1942699
Genome map
AA seq 308 aa AA seqDB search
MKHKYLLFLLGIFCAYQQVNSQEINKKDSLLPIDKKPAVQLGSSLSQIWELDNYTERGTL
KLQIYRPNYILPFRLTDKVNKQPTNFNPSRGIPPYKDYQRMETKFQISLKSKIIQDAFWD
CDIWVGFTQKSYWQVYNEELSRPFRELNYEPEIMFVAPLNFSIGDFKWRMINLSLNHQSN
GKEQTLSRSWNRIILTTAHEWRNFIFITHYWWRFTEDNKEDDNPEITKYVGRAEFNTIYS
YKKHLFNLSIRNNLSFTKNRGYAEFSYIFPIKGDLKAMFQASHGFGDSLIEYNHKQTTIG
LGVVLMEL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaacataaatatctgttgtttttattgggtatattttgtgcatatcaacaagtcaat
tctcaagaaatcaacaaaaaagacagtttgcttcctatagacaaaaaacctgctgtgcaa
ttgggtagttccctttcccaaatatgggagttagataactataccgagcgaggcacccta
aaattacaaatttatcgcccgaattacatcttgccttttcgtcttacggataaagtaaat
aaacaaccaactaactttaatccttctaggggaattcctccttataaagattaccaaagg
atggaaaccaaatttcaaatcagcttaaaatcaaaaatcattcaagatgctttttgggat
tgcgatatttgggttggttttacgcaaaagtcatattggcaagtgtacaacgaggagctt
tcccgaccatttcgtgagctaaattatgagcccgaaataatgtttgtcgctccgttgaat
tttagtattggcgactttaaatggcgaatgataaatctttctttaaatcatcaatctaac
ggaaaagaacagacactttcccgcagttggaatcggataattttaaccacagcacacgaa
tggcgaaactttattttcattacacattattggtggcgatttacagaagataacaaagaa
gacgacaatcctgaaatcactaaatacgtaggaagagcggagtttaacaccatttattct
tacaaaaaacaccttttcaatttatcgatacgcaataatctaagttttactaaaaacaga
ggatatgctgagttttcgtatatcttccccataaaaggcgatttaaaagcaatgtttcaa
gcctcacacggattcggagactcgctaatagaatacaatcacaagcaaactaccattggt
ttgggagtggtgcttatggaactttaa

DBGET integrated database retrieval system