KEGG   Capnocytophaga canimorsus: Ccan_17890Help
Entry
Ccan_17890        CDS       T01582                                 

Definition
phosphatidylcholine 1-acylhydrolase (EC:3.1.1.32 3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ccm00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:ccm00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ccm00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:ccm00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1941773..1942699
Genome map
AA seq 308 aa AA seqDB search
MKHKYLLFLLGIFCAYQQVNSQEINKKDSLLPIDKKPAVQLGSSLSQIWELDNYTERGTL
KLQIYRPNYILPFRLTDKVNKQPTNFNPSRGIPPYKDYQRMETKFQISLKSKIIQDAFWD
CDIWVGFTQKSYWQVYNEELSRPFRELNYEPEIMFVAPLNFSIGDFKWRMINLSLNHQSN
GKEQTLSRSWNRIILTTAHEWRNFIFITHYWWRFTEDNKEDDNPEITKYVGRAEFNTIYS
YKKHLFNLSIRNNLSFTKNRGYAEFSYIFPIKGDLKAMFQASHGFGDSLIEYNHKQTTIG
LGVVLMEL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaacataaatatctgttgtttttattgggtatattttgtgcatatcaacaagtcaat
tctcaagaaatcaacaaaaaagacagtttgcttcctatagacaaaaaacctgctgtgcaa
ttgggtagttccctttcccaaatatgggagttagataactataccgagcgaggcacccta
aaattacaaatttatcgcccgaattacatcttgccttttcgtcttacggataaagtaaat
aaacaaccaactaactttaatccttctaggggaattcctccttataaagattaccaaagg
atggaaaccaaatttcaaatcagcttaaaatcaaaaatcattcaagatgctttttgggat
tgcgatatttgggttggttttacgcaaaagtcatattggcaagtgtacaacgaggagctt
tcccgaccatttcgtgagctaaattatgagcccgaaataatgtttgtcgctccgttgaat
tttagtattggcgactttaaatggcgaatgataaatctttctttaaatcatcaatctaac
ggaaaagaacagacactttcccgcagttggaatcggataattttaaccacagcacacgaa
tggcgaaactttattttcattacacattattggtggcgatttacagaagataacaaagaa
gacgacaatcctgaaatcactaaatacgtaggaagagcggagtttaacaccatttattct
tacaaaaaacaccttttcaatttatcgatacgcaataatctaagttttactaaaaacaga
ggatatgctgagttttcgtatatcttccccataaaaggcgatttaaaagcaatgtttcaa
gcctcacacggattcggagactcgctaatagaatacaatcacaagcaaactaccattggt
ttgggagtggtgcttatggaactttaa

DBGET integrated database retrieval system