KEGG   Capnocytophaga canimorsus: Ccan_20660Help
Entry
Ccan_20660        CDS       T01582                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ccan_20660
   01230 Biosynthesis of amino acids
    Ccan_20660
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ccan_20660
   00051 Fructose and mannose metabolism
    Ccan_20660
   00562 Inositol phosphate metabolism
    Ccan_20660
Enzymes [BR:ccm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ccan_20660
Exosome [BR:ccm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ccan_20660
  Exosomal proteins of bladder cancer cells
   Ccan_20660
  Exosomal proteins of melanoma cells
   Ccan_20660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2223566..2224315
Genome map
AA seq 249 aa AA seqDB search
MRKKIVAGNWKMNNDLKKSTELIADLLKKLPKTEAEVMVAPTFVNLIPATEAAKGTAVEV
IAQNMHFAENGAYTGEISAEMLKSIGVKTVILGHSERRAYFNETDESLAKKADTALKHNI
RMVFCIGEELADRKANNHFKVVENQIKNGLFHLSADAWKNIVLAYEPVWAIGTGETASPE
QAQEMHAFIRKTLADKYGKEVADSVSILYGGSVKPDNAKEIFAKADVDGGLIGGASLKAD
DFIAIINGI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaaattgtagcaggaaattggaaaatgaacaatgacctgaaaaaatcaaca
gaattgatagctgatttattaaaaaaattacctaaaacagaagcagaagtgatggtagct
cctacttttgtgaatttaattcccgcaactgaagcagcaaaaggaactgctgttgaagtg
attgctcaaaatatgcattttgctgaaaacggagcttacacaggtgaaatttcagctgaa
atgttaaaaagcataggcgtaaaaactgtaattttaggacattctgagcgtcgtgcttat
tttaacgaaactgacgagtctttagctaaaaaagcagatacagccttgaaacacaatatc
cgaatggtattttgtatcggagaagaattagcagatagaaaagcaaataatcattttaaa
gtagttgaaaatcagattaaaaacggattgttccatttgtctgccgatgcgtggaaaaat
atcgttttagcctacgaacctgtttgggcaatcggaacgggcgaaactgcctcacctgaa
caagctcaggaaatgcacgcatttattcgtaaaacactcgctgataaatacggaaaagaa
gtagccgacagcgtttcaattctttatggaggtagcgtaaaacctgataatgccaaagaa
atttttgcaaaagcagatgttgatggcggacttattggaggagcgtcactcaaagccgat
gattttatcgcaattattaacggaatttaa

DBGET integrated database retrieval system