KEGG   Capnocytophaga canimorsus: Ccan_21200Help
Entry
Ccan_21200        CDS       T01582                                 

Definition
UDP-MurNAc-tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ccm00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ccm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2271704..2273155
Genome map
AA seq 483 aa AA seqDB search
MNLKDILQNIEIISLSGEINTQVGDLVQDSRLIKQGDVFVAIKGTASDGHQFISKAIEMG
AKVIVCEEIPQETISEIVYVKVKDSVSALATMASNFYGNPSEKLKLVGITGTNGKTTTTS
LLYQLFRKVGYKVGLISTIAIYVDEQKYDTKNTTPDILTLNKYLKMMVDAGCEYCFMEVS
SHGVEQRRIEGLQFAGGVFTNLTHDHLDYHQTFANYRDAKKKFFDQLPKTAFALTNIDDK
NGSVMLQNTKAQKKSYALKTMADYRLQILENQFSGLVLKIDGQEVWTNLIGQFNAYNLLA
VYAVADLLRIEKIQNLTALSTLQSVGGRFQYFVSKDKITAIVDYAHTPDALQNVLDTINN
IRTKNEQLITVVGCGGNRDKSKRPVMADISTKESTRVIFTSDNPRDEDPQTILDEMEAGV
SAEHYKKFVTIADRRQAIKTACQFAQSGDIILIAGKGHETYQEIKGERTHFDDMEEVKKI
LNV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaacctaaaagatatattacaaaacatagaaatcatctccctttcgggggaaatcaat
acccaagtaggtgatttggtgcaagactcgcggttaattaaacaaggcgatgtattcgtt
gctataaaaggtacggcatcagacggacatcaattcattagcaaagccatcgaaatggga
gcaaaagtcatcgtttgtgaggagattccgcaagaaactatttcggaaattgtttatgta
aaagtaaaggatagcgtttccgctttggcaacgatggcgagtaatttttacggaaatcca
tcagaaaaactcaagttagtggggataacaggcacaaacggaaaaaccaccaccacgagt
ttgctatatcaattgtttagaaaagtgggctacaaagtgggactgatttccaccatcgcc
atttatgttgatgagcagaagtacgataccaaaaacactacacccgacattcttacattg
aacaaatatctgaaaatgatggtcgatgcaggttgtgaatattgctttatggaagtgagt
tcgcacggcgtggagcaacgacgcatcgaaggcttacaatttgcagggggcgtgtttacg
aatctcacacacgaccatttggattatcaccaaacctttgccaactatcgtgatgccaaa
aagaagtttttcgaccaattgcccaaaacagcttttgctcttaccaatatcgacgataaa
aatggcagtgtgatgttgcaaaataccaaagcccaaaagaaatcgtacgctctgaaaaca
atggcggattatcgtttgcagattttggaaaaccagttttcgggcttggtactgaaaata
gacggacaggaagtttggacaaacctcatcgggcagttcaacgcttataatcttttggcg
gtttatgctgtcgccgatttgctcagaatcgaaaaaattcagaacctaaccgctttgagt
actttgcagtcggtgggcggaaggtttcagtattttgtttcgaaagacaaaatcaccgca
attgtggattatgctcacacgcccgacgctttgcaaaatgttttggacaccatcaacaac
attcgcactaaaaacgagcaactcatcacggtggtaggctgcggaggcaatcgcgacaag
agcaaacgccctgtaatggcggatatttccacgaaggaaagtacccgagtaattttcact
tcagacaatccgcgagacgaagacccacaaacgattttggacgaaatggaagcaggtgta
tcagcagagcattacaaaaagtttgttaccatagccgaccgccgtcaggcaataaaaacc
gcttgtcagtttgctcaatcaggggatattatcctcattgcagggaaaggacacgaaacc
tatcaagaaatcaaaggcgaacgcacccattttgacgatatggaagaagtgaaaaaaata
ttgaacgtgtag

DBGET integrated database retrieval system