KEGG   Capnocytophaga canimorsus: Ccan_21900Help
Entry
Ccan_21900        CDS       T01582                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ccm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2359209..2359793)
Genome map
AA seq 194 aa AA seqDB search
MITQIQGKLVEKNPTHLVVDCHGVGYFVNITLNTYSTLPQNEAIKLYTYLQIKEDAHNLY
GFLTKAEREVFVLLISVSGVGAGTARTMLSSLTAAQVRSAIINGDVATIQSVKGIGAKTA
QRVILDLKEKMTKLQDFEDIPYNEVNTNKEEALAALEVLGFVRKQAEKVVDRIIRTSSEQ
LSVEEIIKQALKNL
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgataacccaaattcaaggaaaattggttgaaaaaaatcctacgcatttggtggtagat
tgccacggggtggggtattttgtcaacataacactgaatacctatagtacattgcctcaa
aatgaagctattaaactttatacttacttgcagataaaagaagatgctcataacctttat
ggttttttaactaaagccgaacgtgaggtttttgttttacttatctctgtatctggggtg
ggagcaggaacggcacgtacgatgctctcttcgcttaccgcagcacaagtacgcagtgct
attataaatggtgatgtagctacgatacaatcggttaaaggtattggagcaaaaacggct
caacgcgtaattttagatttgaaagagaaaatgaccaaacttcaagattttgaagatatc
ccttataatgaagtaaatactaataaggaagaggcacttgcggcattggaagttttaggt
tttgttcgtaaacaagccgaaaaagtagttgaccgaattatacgaacctcttctgaacaa
cttagtgtagaagaaatcattaaacaagcccttaaaaacttataa

DBGET integrated database retrieval system