KEGG   Corynebacterium callunae: H924_01885Help
Entry
H924_01885        CDS       T02507                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ccn  Corynebacterium callunae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    H924_01885
Enzymes [BR:ccn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     H924_01885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
425432..426793
Genome map
AA seq 453 aa AA seqDB search
MRFAIIGAGLAGLTAAYEIHKADPAAHIDVLEAGERIGGKLFTVPFSSGPTDIGAEAFLA
ARSDALEFFQELGLGDSLVAPSGAKSQFFAGGTLQEFPAGGVMGIPATPPAGAADAPFEW
TPGSDISVGALVRQQYGDEIVDSVVSSLLGGVYSSTADDLGLRASVPALAAALDQLAEAG
QPVTLSAAVKAVEAQRAATKKTAETRPVFQTFKGGYAELYEALAEQCGADIHLDCFVSAI
TKSGAGFAIKGGGEGIYDRVILAVPAPTAAVLLRDLTPAAGNHLKAIKLASSAVVGMHFD
DATGLPENSGVLVAVGEPGITAKAFTFSSKKWPHIAERGGALIRASFGRLGDEKTARMDE
DALVDAALDDLQTITGFDGRAAGLSEIYVQRWFGGLPAYGVDHIQTVAAARAEIAVIPGL
EAIGAWAGGVGVPAVIADARAAVQRLLQLPTNS
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgccatcatcggagcaggacttgcaggtttaactgcagcctatgaaatccac
aaggctgatccagcagcccatattgatgtccttgaggcaggggagcgtatcggtggcaaa
ttgttcactgtgcctttttcctcaggccccaccgatattggtgcagaagctttcttagca
gcgcgctctgacgccctggagttcttccaagagcttggcctgggtgattctctggtggcg
ccatcaggtgcgaaatcccagttttttgcaggtggcaccttgcaggagtttcctgccggg
ggcgtaatgggtatccccgccaccccaccggcaggagcagcagatgcaccttttgaatgg
accccggggtctgatatttcagttggtgctttggtgcgtcagcaatacggcgatgaaatc
gtcgatagcgttgtctcctccttgttgggtggcgtttattcatccactgccgatgatctg
ggcctacgtgctagcgttccggcgttggctgctgccttggatcaactggcggaggctggc
cagccagttacgctaagcgctgcagttaaagctgtagaagcccagcgcgctgcaactaaa
aagactgcggaaactcgcccagtattccaaaccttcaaaggtggatacgccgagctttat
gaggctttggcagaacaatgcggcgccgatattcacttagattgctttgtctctgcaatt
accaagtccggtgccggatttgccatcaagggcggtggcgaaggcatttatgatcgcgtg
attttggcggtgccagcaccaactgcagccgttttgcttcgtgatctcaccccagctgca
ggaaatcaccttaaggccattaagttggcttcctctgcagtggtgggcatgcactttgat
gatgccaccggcctgccagaaaactcgggcgtgttggtggccgtgggtgagcctggaatt
actgccaaggccttcaccttctcctcgaagaagtggccacatatcgctgagcgtggcggc
gcactaattagagcttcctttggccgtctcggggatgaaaagaccgcccgaatggatgaa
gatgctcttgtggatgcagcacttgatgatctccagaccattactggttttgatggccgt
gctgcaggattgtcagaaatttatgtgcagcgctggtttggtggattacctgcctatggt
gttgaccacattcaaaccgtggctgctgcgcgcgccgaaattgctgtgattccagggcta
gaggccatcggcgcgtgggctgggggagtgggagtgcctgcagttattgcagatgcgcgt
gctgctgtgcagcgacttctgcagcttcccaccaacagctaa

DBGET integrated database retrieval system