KEGG   Corynebacterium callunae: H924_06295Help
Entry
H924_06295        CDS       T02507                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
ccn  Corynebacterium callunae
Pathway
ccn00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ccn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    H924_06295
Enzymes [BR:ccn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     H924_06295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AGG66703
UniProt: M1UYP4
Position
complement(1345991..1346914)
Genome map
AA seq 307 aa AA seqDB search
MSNSTCTDIVVVGSINADLTAKVQRHPEPGETLLGSGGTVSAGGKGANQAVAAAQLGAKV
TMIGAVGTDQMAGEALTHMRQSGADMSAIAIVDGPTGLAIITVSDDGENSIIVIPGANAS
VTAEFVDKHSQLIENSGIVLLQGEIPADGFERAVDLSQGRVVINLAPVVSVGHVQLRRAD
PLLVNEHEGALVLDMLGTPATTSDPQGLVAELLNQGFASVVMTLGAEGALVGTPGQLTEI
PTPKIQAVDTTGSGDAFAGALVAKLSEGAGLIEAATFAARVGAYAATKPGAQASYPTLTT
ELPSIIH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactcaacctgtaccgacattgtcgttgttggatccatcaatgccgatctcacc
gccaaagttcaacgccaccctgaacccggagaaaccctcctgggcagcggcggcacagtt
agtgctggtggcaaaggtgccaatcaagctgtggcggcagcacaattaggtgccaaagtc
accatgatcggtgcggttggaactgatcaaatggctggcgaggcgctgacacacatgcgt
caatcaggagcagatatgtccgcgattgccattgtggatggtcccactggtcttgccatc
atcactgtgtctgacgatggggaaaactccatcattgttatccctggtgcaaacgcgtct
gtcacagcggaatttgttgataaacattcccaactcattgagaattccggcatcgtgttg
cttcaaggtgagatccctgccgatggtttcgagcgtgccgtcgatctttcacaaggacgt
gtggtgatcaatttggctccagttgtgtccgtgggccatgttcagctgcgtcgtgcagat
ccattgctggtcaatgaacacgaaggtgctctggtgctggacatgctcggaacaccagcg
accacttcggatccccaaggattggtcgcggaattgctgaatcagggttttgcttccgtg
gtgatgacccttggtgccgaaggtgctctggttggcacacctggccaactcacggaaatc
cctacccccaaaatccaggcagtcgacacaaccggaagtggagacgcgtttgcgggggca
ctcgtcgcaaagctttctgaaggtgctggccttattgaggccgcaacttttgctgcgcgc
gttggcgcctatgccgcaaccaaaccgggtgctcaagcctcctaccccaccctgaccact
gaactcccctcaatcattcactga

DBGET integrated database retrieval system