KEGG   Corynebacterium callunae: H924_08730Help
Entry
H924_08730        CDS       T02507                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ccn  Corynebacterium callunae
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ccn03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1875188..1876042)
Genome map
AA seq 284 aa AA seqDB search
MPELPEVEVVRRGLAEHAAGHTIVQAAIYHPRVVRNQLGGAVEVESNLRGLKISAAKRRG
KFLWLELADALNQPTNLGLLVHLGMSGQMLIKDPDSPISPHLRAKLQLDDGHEVWFVDQR
TFGYWWLGDIHEGVPTKISHIAPDLLEDAADSPAVALQLKARGREIKRLLLEQQIVSGIG
NIYADEMLWAAQIHPQQRSDRLSLQRLEYLLECGRKVMIKALAQGGTSFDALYVNVNGNS
GYFSLSLNAYGQTDEPCARCGTPISKIVVGGRGTHYCSKCQRRH
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgaattacctgaagtagaagtagtccgccgtgggttagctgaacacgcggcgggt
cacaccattgtgcaggctgcgatctatcatcctcgagtggttcgcaaccaactaggtggg
gcagtagaggtggaatcaaacctccgaggtttaaagatctccgcagctaagcgccgtggc
aaatttttgtggttggaattggcagatgctttaaaccaacccacaaaccttggactattg
gtacacctggggatgagtggccaaatgctcattaaggatccagattctcccattagccct
catctgcgcgctaaattgcagcttgatgatggtcatgaagtgtggtttgtggatcagcgc
acctttggatattggtggcttggtgatatccacgaaggtgtccccaccaagatttcacat
atcgcacccgaccttttggaagatgctgccgattctccagcggttgcattgcagcttaaa
gctcgtggtcgagaaattaaacgtcttttgctagagcaacaaattgtctcagggataggc
aatatttatgccgatgagatgctgtgggcagcccagattcacccgcagcagcgctctgat
cggctgtctttacaacgcctggaatatcttttggaatgtggccgcaaagtaatgatcaag
gccttagctcagggcggtacttcctttgatgctttgtatgtcaatgtcaacggaaattct
ggttatttttcgctttccctcaatgcttatggccaaaccgatgagccatgtgcacgttgt
ggcaccccaatttccaaaattgtggtgggaggccgaggtactcattactgctctaagtgt
cagcgtcgccactag

DBGET integrated database retrieval system