KEGG   Corynebacterium callunae: H924_08845Help
Entry
H924_08845        CDS       T02507                                 

Gene name
hisD
Definition
(GenBank) bifunctional histidinal dehydrogenase/histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ccn  Corynebacterium callunae
Pathway
ccn00340  Histidine metabolism
ccn01100  Metabolic pathways
ccn01110  Biosynthesis of secondary metabolites
ccn01230  Biosynthesis of amino acids
Module
ccn_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ccn00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    H924_08845 (hisD)
Enzymes [BR:ccn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     H924_08845 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AGG67207
UniProt: M1UUZ9
Position
complement(1897943..1899271)
Genome map
AA seq 442 aa AA seqDB search
MLNVTDLRGQTPSKSDIRRALPRGGTDVVSVLPIVQPVVDDVKERGAHAALEYGEKFDHI
RPASVRVPAEVLAGAEAALDPLVRASIEESIKRVRKVHAEQKPQSHTTELAPGGTVTEKF
LPIDRVGLYVPGGNAVYPSSVIMNTVPAQEAGVSSLVVASPPQAEHGGWPHPTILAACSI
LGVTEVWAVGGGQAVALLAYGDEAEGLDPVDMITGPGNIFVTAAKRLVRGVVGTDAEAGP
TEIAILADGTANPVNVAYDLISQAEHDVMAASVLITDSEGLAAAVNREIAARYSITRNAD
RVAQALEGKQSGIVLVDDITVGIQVADQYGAEHLEVHTENARAVAEKITNAGAIFVGDFS
PVPLGDYTAGSNHVLPTSGTSRFSAGLSTHTFLRPVNLIEYDEAALKEVSDVVINFANAE
DLPAHGEAIRARFETLPTTDEA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatgtcactgacctgcgcggtcaaacaccatccaagagcgatatccgacgcgca
ctgccacgcggaggcacggacgtagtgtccgtacttcccatcgtgcagcctgtggtggat
gacgtaaaagaacgcggcgcccatgctgccttggaatatggcgagaaatttgatcatatt
cgccccgcttcggtgcgggttcctgcagaggttctggctggtgctgaagctgctctagat
cccttggtacgcgcctccatcgaggaatccattaagcgggtacgcaaagtccacgctgag
caaaagccacagtcacacaccaccgagctggcacctggtggcaccgtcactgagaaattc
ctacccatcgaccgcgtgggactatatgttccaggtggtaatgccgtttacccatccagc
gtcattatgaacaccgttccagcccaagaagctggggtatctagcctggttgtggcatct
ccaccacaggctgagcacggcggttggccacaccccaccattttggcagcctgctctatt
ttgggtgtgaccgaagtgtgggcagtgggcggtggccaagcggtcgcactattggcttat
ggcgatgaggctgaagggctggatccagttgatatgatcaccggcccgggaaacatcttt
gtcaccgcggcaaagcgtttggtccgcggtgtagtgggaaccgatgcagaagcaggcccc
acagagatcgcaattttggcagatggcaccgccaacccggtcaatgtggcatatgacctg
atcagccaggccgaacacgatgttatggccgcctcggttttgattaccgattctgaaggg
ctggcagcagctgtcaatcgcgaaattgcggcccgctattccattacccgcaacgcggat
cgtgtagctcaagcactggaagggaaacaaagcggaattgtgcttgtcgacgacatcacc
gtaggcatccaggttgccgatcagtacggcgccgagcaccttgaggtgcacaccgaaaat
gcgcgtgcagttgcggaaaagatcaccaatgctggcgctatctttgttggcgatttttcc
ccagtcccactcggtgattacaccgcaggctctaaccacgtgctgccaacctcgggcacc
tcgcgtttttctgcaggtctttccacccacaccttcctacgcccggtaaacctcattgaa
tatgatgaagcagccttgaaggaagtttctgatgtggtgattaactttgccaatgcagaa
gatttgcctgcccacggtgaggcaattcgtgctcgctttgaaactcttcccaccactgat
gaggcctaa

DBGET integrated database retrieval system