KEGG   Corynebacterium callunae: H924_09670Help
Entry
H924_09670        CDS       T02507                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ccn  Corynebacterium callunae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    H924_09670
Enzymes [BR:ccn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     H924_09670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2085503..2087650
Genome map
AA seq 715 aa AA seqDB search
MTARGPLNELAVLYGVSTSYTDYKGAHVEVSDDTLVKILRALKVDLGAPETTDPSDEVLN
QAIARFHDREFSRPLPPCVVAIQGTEVTFPVHVHDGAPAAVHITLEDGSTRETFQVENWT
PPREIDGITWGEASFKIPADLPLGWHQLHLTSDELEYSCGLIITPARLSTADKYLQSPRT
GVMAQIYSVRSTLSWSMGDFNDLGKLASVVAQDGADFLLINPMHAAEPLPPTEDSPYLPT
TRRFINPIYLRVEDVPEFNQLDIELRDDVAELAEEFRERNLSAEIIERNDVYSAKLQVLH
AIYDLPRTAEREASFVDFVQREGQGLIDFATWCADREIEQSASAHAELPDRDELTMFYMW
LQWLCDEQLAEAQKRALDAGMSIGIMADLAVGVHPGGADAHNLEYVLAPDASVGAPPDGY
NQQGQDWSQPPWHPVRLAEEGYIPWRNLLRTVLRHSGGIRVDHVLGLFRLFVMPRMQSPA
TGTYIKFDHEALVGILALEAELADAVVIGEDLGTFEPWVQDALAQRGIMGTSILWFEHSP
TQPGPRLQSEYRPLALSSVTTHDLPPTAGYLAAEHIELREKLGVLSTDPEVEAAEDLQWQ
AEILDAAVAAGALAPSAQEDGSYVGLPREQRGSLPELMAGLHAFVAGTPSALTCVSLVDM
VGDKRAQNQPGTTRDLYPNWCIPLCDNDGEPVSIEALRDNELYHTVAEAARRPQQ
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcacgaggacctttgaatgaattggccgtcctatacggcgtatccacttcctac
accgattacaagggcgcacatgtagaggtcagcgacgacactctagtgaagatcctccgc
gccttaaaggtggatcttggtgccccagagaccaccgaccctagcgatgaggtactcaac
caagccattgcgcgcttccacgaccgcgagttctctcgccctttgccaccttgtgtggtg
gcaatccaaggcactgaagtaactttcccagtccatgtgcatgacggtgctcccgcagcc
gttcatatcaccttggaagatggcagcacccgcgagactttccaggtagaaaactggacg
ccaccccgcgagatcgacggcattacctggggcgaagcctcctttaagatcccagctgat
ctgcccttgggctggcaccagcttcacctcacctctgatgagttggaatatagctgtggt
ttgatcatcaccccggcgcgcctgtctactgctgataagtatctgcaatcacctcgtacc
ggtgtgatggcccagatttactccgtgcgctctaccctgtcctggagcatgggcgacttt
aatgacctgggcaagctggccagtgtggtggcccaagacggcgctgacttcctgctgatt
aaccccatgcacgcagctgagccactgccaccaaccgaagattctccttatttgccaact
actcgtcgctttatcaatccgatttatctgcgtgtagaagatgttccagagttcaatcag
cttgatattgaacttcgtgatgatgttgccgagctggctgaggaattccgagagcgcaat
ctaagcgctgagatcatcgagcgtaatgatgtttattccgccaaactgcaggttttgcat
gctatttatgatctcccccgcactgctgagcgggaagcatcctttgtggactttgtgcag
cgcgaaggacaagggctcattgactttgcaacctggtgtgcagaccgtgaaattgagcaa
tctgcctccgcccatgcagaattgccagatcgcgatgaactaaccatgttctatatgtgg
ttgcagtggctgtgtgatgagcagctggccgaagctcaaaaacgcgcccttgatgccggt
atgtccatcggtatcatggctgacttggcagttggtgtgcacccaggtggcgccgatgcc
cacaacttggaatatgtgctggctcctgatgcttccgtcggagctccaccagatggctat
aaccaacagggccaggactggtctcagccaccgtggcacccagttcgtttggcagaggaa
ggctatattccttggcgtaacctgctgcgtaccgtattgcgtcactccggtggcatccgc
gtagatcacgtcctcggcttgttccgcctctttgttatgcctcgtatgcagtcgcctgca
accggtacctatatcaagttcgaccatgaagctttggttggcatcctggcgcttgaggca
gagttggcagatgcggtggttattggtgaggatcttggcacctttgagccttgggttcag
gatgctttggcgcagcgcggcattatgggcacctcaatcctgtggtttgagcattctcca
acccagcctgggccacgcctgcaaagtgaataccgtccgctcgcattgagctcggtcacc
acccacgatctacctccaactgcgggatacttggctgcggagcatattgagttgcgtgaa
aagctgggcgttctcagcaccgatccagaggttgaagcagccgaggatctgcagtggcag
gctgaaattcttgatgctgcggtagcggctggtgccttggctccaagtgctcaagaagat
ggcagttacgtgggtctccctcgtgaacagcgcggaagcctgccagagctcatggctggt
ttgcatgcttttgttgctggtacaccgtccgcactgacctgtgtatccctggtggatatg
gttggcgataagcgcgcgcagaatcaaccaggcactactcgcgatctctaccccaactgg
tgtatcccactctgcgataacgacggcgagccagtaagtattgaggcacttcgggataac
gagctttatcacaccgtggccgaggcagcccgccgcccacaacagtag

DBGET integrated database retrieval system