KEGG   Corynebacterium callunae: H924_09795Help
Entry
H924_09795        CDS       T02507                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ccn  Corynebacterium callunae
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    H924_09795
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    H924_09795
Enzymes [BR:ccn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     H924_09795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2114048..2115346
Genome map
AA seq 432 aa AA seqDB search
MSNVGKPRTAQEIQQDWDNNPRWNGITRDYTAQQVAELQGSVVEEHTLARRGAEILWDAV
SQEGEGYINALGALTGNQAVQQVRAGLKAVYLSGWQVAGDANLSGHTYPDQSLYPANSVP
SVVRRINNALLRADEIARVEGDDSIDNWLVPIVADGEAGFGGALNVYELQKAMITAGAAG
THWEDQLASEKKCGHLGGKVLIPTQQHIRTLNSARLAADVADTPTVVIARTDAEAATLIT
SDVDERDQPFITGERTAEGYYHVKNGLEPCIARAKSYAPYADMIWMETGTPDLELAKRFA
EGVRSEFPDQLLSYNCSPSFNWSKHLEAEEIAKFQRELGAMGFKFQFITLAGFHSLNYAM
FDLAYGYARNGMTSFVDLQNREFAAAEERGFTAVKHQREVGAGYFDTIATTVDPNSSTTA
LKGSTEEVQFQH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgtaggaaagccacgcaccgcacaggaaattcagcaggactgggataacaat
ccacgctggaacggcatcacccgcgactacaccgcacagcaggtagcagagcttcagggt
tcagttgttgaagagcacaccctggcacgccgcggagctgaaatcctctgggatgcagta
tcccaagagggcgaaggctacatcaacgcacttggcgcacttaccggcaaccaggcagtt
cagcaggttcgcgctggactcaaggctgtttacctttccggttggcaggtcgctggagat
gcaaacctctccggccacacctaccctgaccagtccctctaccctgccaactcggttcct
tcggttgttcgtcgcatcaacaacgccttgttgcgtgccgatgaaatcgcgagagttgaa
ggcgatgattccatcgacaactggctcgttccaatcgtggccgatggtgaagctggcttc
ggtggcgctcttaacgtctacgagctgcaaaaggcaatgatcaccgctggtgccgccggc
acgcactgggaagatcagcttgcttctgagaagaagtgtggacaccttggtggcaaggtt
ttgatcccaacccagcagcacattcgtacccttaactccgcacgtttggctgccgatgtt
gccgataccccaactgtggttattgctcgcaccgatgctgaggctgcaaccctgatcacc
tctgatgttgatgagcgcgatcagcctttcatcaccggtgagcgcaccgccgaaggttac
taccacgttaagaatggtctggagccttgtatcgctcgcgccaagtcttatgctccatat
gcagacatgatctggatggagactggtactcctgacctggagttggcaaagcgcttcgct
gaaggtgtgcgttctgaattcccagatcagctcctgtcctacaactgctccccttccttc
aactggtctaagcacctagaggcagaagagatcgctaagttccaacgtgagctgggagct
atgggcttcaagttccagttcatcaccttggctggtttccactccctcaactacgcaatg
ttcgatcttgcctacggttacgctcgcaatggcatgacctccttcgttgacctgcaaaac
cgtgagttcgcagcagcggaagagcgcggcttcaccgccgtcaagcaccagcgcgaggtt
ggcgcaggttacttcgacaccatcgcaaccaccgtggatccaaactcttccaccaccgcc
ctcaagggttctactgaggaagttcagttccagcactaa

DBGET integrated database retrieval system