KEGG   Corynebacterium callunae: H924_09795Help
Entry
H924_09795        CDS       T02507                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ccn  Corynebacterium callunae
Pathway
ccn00630  Glyoxylate and dicarboxylate metabolism
ccn01100  Metabolic pathways
ccn01110  Biosynthesis of secondary metabolites
ccn01120  Microbial metabolism in diverse environments
ccn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    H924_09795
Enzymes [BR:ccn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     H924_09795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AGG67397
UniProt: M1UVE1
Position
2114048..2115346
Genome map
AA seq 432 aa AA seqDB search
MSNVGKPRTAQEIQQDWDNNPRWNGITRDYTAQQVAELQGSVVEEHTLARRGAEILWDAV
SQEGEGYINALGALTGNQAVQQVRAGLKAVYLSGWQVAGDANLSGHTYPDQSLYPANSVP
SVVRRINNALLRADEIARVEGDDSIDNWLVPIVADGEAGFGGALNVYELQKAMITAGAAG
THWEDQLASEKKCGHLGGKVLIPTQQHIRTLNSARLAADVADTPTVVIARTDAEAATLIT
SDVDERDQPFITGERTAEGYYHVKNGLEPCIARAKSYAPYADMIWMETGTPDLELAKRFA
EGVRSEFPDQLLSYNCSPSFNWSKHLEAEEIAKFQRELGAMGFKFQFITLAGFHSLNYAM
FDLAYGYARNGMTSFVDLQNREFAAAEERGFTAVKHQREVGAGYFDTIATTVDPNSSTTA
LKGSTEEVQFQH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgtaggaaagccacgcaccgcacaggaaattcagcaggactgggataacaat
ccacgctggaacggcatcacccgcgactacaccgcacagcaggtagcagagcttcagggt
tcagttgttgaagagcacaccctggcacgccgcggagctgaaatcctctgggatgcagta
tcccaagagggcgaaggctacatcaacgcacttggcgcacttaccggcaaccaggcagtt
cagcaggttcgcgctggactcaaggctgtttacctttccggttggcaggtcgctggagat
gcaaacctctccggccacacctaccctgaccagtccctctaccctgccaactcggttcct
tcggttgttcgtcgcatcaacaacgccttgttgcgtgccgatgaaatcgcgagagttgaa
ggcgatgattccatcgacaactggctcgttccaatcgtggccgatggtgaagctggcttc
ggtggcgctcttaacgtctacgagctgcaaaaggcaatgatcaccgctggtgccgccggc
acgcactgggaagatcagcttgcttctgagaagaagtgtggacaccttggtggcaaggtt
ttgatcccaacccagcagcacattcgtacccttaactccgcacgtttggctgccgatgtt
gccgataccccaactgtggttattgctcgcaccgatgctgaggctgcaaccctgatcacc
tctgatgttgatgagcgcgatcagcctttcatcaccggtgagcgcaccgccgaaggttac
taccacgttaagaatggtctggagccttgtatcgctcgcgccaagtcttatgctccatat
gcagacatgatctggatggagactggtactcctgacctggagttggcaaagcgcttcgct
gaaggtgtgcgttctgaattcccagatcagctcctgtcctacaactgctccccttccttc
aactggtctaagcacctagaggcagaagagatcgctaagttccaacgtgagctgggagct
atgggcttcaagttccagttcatcaccttggctggtttccactccctcaactacgcaatg
ttcgatcttgcctacggttacgctcgcaatggcatgacctccttcgttgacctgcaaaac
cgtgagttcgcagcagcggaagagcgcggcttcaccgccgtcaagcaccagcgcgaggtt
ggcgcaggttacttcgacaccatcgcaaccaccgtggatccaaactcttccaccaccgcc
ctcaagggttctactgaggaagttcagttccagcactaa

DBGET integrated database retrieval system