KEGG   Corynebacterium callunae: H924_10450Help
Entry
H924_10450        CDS       T02507                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ccn  Corynebacterium callunae
Pathway
ccn00220  Arginine biosynthesis
ccn00250  Alanine, aspartate and glutamate metabolism
ccn00471  D-Glutamine and D-glutamate metabolism
ccn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H924_10450
   00220 Arginine biosynthesis
    H924_10450
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    H924_10450
Enzymes [BR:ccn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     H924_10450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase STAS
Motif
Other DBs
NCBI-ProteinID: AGG67518
UniProt: M1V019
Position
complement(2249101..2250369)
Genome map
AA seq 422 aa AA seqDB search
MCANKLTMPIPEYLSEILESVRANTAGEVANYIPELKKADPNPLAIAICTVDGRIYSAGD
DEVEFTMQSISKPFAYALALQECGADQVFDTVAVEPSGEAFNELSLDGSNRPMNPMINAG
AIAINQLINGSDSSVEDRVEKIRKYFSELAGRELMIDRRLTESELVGADRNLSIAHMLRN
YGVIDDDAHDAVLSYTLQCAIKITVRDLAVMTATLAAGGVQPITGKKLIDTKVCRLTLSV
MASAGMYNEAGQWLSTVGIPAKSGVAGGLIGILPGQLGISTFSPRLNAQGNSVRGVEIFK
TLSDDMGLHLMSTEPVAVHAVRTITEKDGVTTIRLQGAMNFSAGENFLHEIQQHQFEGEM
VVLDLSRVITLHPMAMRMIKEGLKRIRDAGFKVAIVDPDNVLPNFTFSDGTLCAQLASER
DL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgccaataagttgaccatgcccattcccgaatacctctccgaaattctcgaatca
gtgcgtgcaaacaccgctggcgaggtagctaattacattcctgaacttaaaaaagccgac
cctaatccgctggctattgccatctgcactgtggatggacgcatttatagtgctggtgat
gatgaagttgagttcaccatgcaaagtatttccaagccttttgcttatgcgctggcactt
caagaatgtggcgctgatcaggtctttgacaccgttgccgtggaaccttccggcgaggca
tttaatgaactttccctagatggttcaaatcggcccatgaaccccatgattaatgcggga
gccattgctattaaccagctaattaatggctcagattcctcggtggaagaccgcgtggag
aagattagaaagtacttttctgagcttgcgggccgtgagctcatgattgatcggcgcttg
accgaatctgaattagtaggcgctgaccgcaatctctcgattgcccatatgctgcgcaat
tatggcgtcattgatgatgatgcccatgacgcagtgctcagctataccttgcagtgtgcc
attaaaatcaccgtgcgggatttggccgttatgacagcaacgctggcagctggtggagta
caaccgatcaccggcaaaaaactaattgataccaaggtttgccgtttaactctttcagta
atggcttctgccggtatgtataacgaggcaggccagtggttatccaccgtgggaattcca
gcaaaatctggagttgccggcggattaattggtatcttgcctggtcaattgggtatttcc
accttctcgccccggctaaatgcccaaggaaatagtgtgcgcggcgtagagatcttcaaa
accctttctgacgatatgggcctgcacctgatgtccactgaaccagttgcagttcatgcg
gtgcgcacgattactgaaaaggatggggtaaccaccattcgtcttcaaggcgctatgaac
ttctctgccggggagaatttcctgcatgagattcagcagcaccagtttgagggcgagatg
gtggtattggatctcagccgtgtgattactctccaccctatggccatgcgcatgattaaa
gaaggtctcaagcgtatccgcgatgctggatttaaggttgccattgttgatccggataat
gttttgccgaattttactttctctgatggcaccctttgcgcccagcttgcttcggagcga
gatttatag

DBGET integrated database retrieval system