KEGG   Corynebacterium callunae: H924_11945Help
Entry
H924_11945        CDS       T02507                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ccn  Corynebacterium callunae
Pathway
ccn00220  Arginine biosynthesis
ccn00250  Alanine, aspartate and glutamate metabolism
ccn00290  Valine, leucine and isoleucine biosynthesis
ccn01100  Metabolic pathways
ccn01110  Biosynthesis of secondary metabolites
ccn01130  Biosynthesis of antibiotics
ccn01210  2-Oxocarboxylic acid metabolism
ccn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H924_11945
   00290 Valine, leucine and isoleucine biosynthesis
    H924_11945
   00220 Arginine biosynthesis
    H924_11945
Enzymes [BR:ccn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     H924_11945
    2.6.1.66  valine---pyruvate transaminase
     H924_11945
Amino acid related enzymes [BR:ccn01007]
 Aminotransferase (transaminase)
  Class I
   H924_11945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGG67812
UniProt: M1UW25
Position
2588666..2589979
Genome map
AA seq 437 aa AA seqDB search
MTTDKRKTSKTTDTATKAVGADQAARPTRRPRRRIFDQSEKMKDVLYEIRGPVAAEAERM
ELDGHNILKLNTGNPAIFGFDAPDVIMRDMIANLPLSQGYSTSKGIIPARRAVVTRYEVV
PGFPHFDVDDVFLGNGVSELISMTTQALLNDGDEVLIPAPDYPLWTAATSLAGGKPVHYL
CDEEDDWNPSIEDIRSKITDKTKAIVVINPNNPTGAVYPRRVLEEIVAIAREHDLLILAD
EIYDRILYDGAEHISLATLAPDLLCITYNGLSKAYRVAGYRAGWMVITGPKQYARGFIEG
LELLAGTRLCPNVPAQHAIQVALGGRQSIYDLTGEHGRLLEQRNVTWEKLNEIPGVSCVK
PMGALYAFPKLDPNVYEIHDDTQLMLDLLRAEKILMVQGTGFNWPHPDHFRVVTLPWASQ
LENAIDRLGNFLSSYKQ
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgactacagacaagcgcaaaacctctaagaccaccgacaccgccaccaaggctgtgggc
gcggatcaggcggcgcgtcccactcgacggcctcgccgtcgcatcttcgatcagtcggag
aagatgaaggacgtgttgtacgagatccgtggcccggtggccgcggaggcggaacgcatg
gaacttgatggacataatatcctcaagctcaacaccggcaaccccgcaatcttcggcttt
gatgcccccgatgtgatcatgcgcgacatgattgccaacctcccgctttcccagggttat
tccacctcaaagggcattattccagcccggcgcgcagtggtaacccgctatgaagtggtg
cccggattcccccactttgatgttgatgatgtcttcttgggcaatggtgtttctgagcta
atcagcatgaccacgcaggctctcctcaatgatggtgatgaagtgctaatcccagcaccg
gactatccattgtggaccgcagcaacttcccttgctggtggcaagcctgtgcactacctc
tgtgatgaggaagatgattggaatccttctatcgaggacatccgatccaagatcaccgac
aagaccaaggccattgtggtgatcaaccccaataacccaactggtgcggtatatccgcgc
cgggttttggaggagatcgtagctatcgcccgcgagcatgatctattgatcctggctgat
gagatctatgaccgcattctctacgatggtgccgagcacatcagcctggcaactctcgcc
cctgacctgctctgcatcacctataacggcctctccaaggcttatcgtgtggccggttac
cgtgctggctggatggtcattaccggacctaagcaatatgctcgtggcttcatcgagggc
ttggagctcttggccggtactcgcctctgccccaatgtgcctgcgcagcatgcgattcag
gtggctttgggtggacgccagtccatctatgacctcaccggcgagcatggccgcctcctg
gagcagcgcaatgtgacctgggaaaagctcaatgagattccaggtgtcagctgcgttaag
ccaatgggtgcgctttatgccttccccaagctggatcccaatgtctatgaaattcacgat
gacacccagttgatgcttgatctgctgcgcgctgagaagattctcatggtgcagggcacc
ggttttaactggccacatccagaccacttccgcgtggtcaccttgccatgggcttcccaa
ttggaaaacgctatcgaccgtcttggtaacttcctatcaagttacaagcagtag

DBGET integrated database retrieval system