KEGG   Campylobacter concisus: CCC13826_0154Help
Entry
CCC13826_0154     CDS       T00593                                 

Definition
glycoside hydrolase family 3 protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cco  Campylobacter concisus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CCC13826_0154
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CCC13826_0154
Enzymes [BR:cco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CCC13826_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
861041..862096
Genome map
AA seq 351 aa AA seqDB search
MRAFKFILFVAIFVLGLNGAEVSLRAKVSQMIMVGFNGASTKDAAFRAMLSDAGYERFGG
VMLLGRNVTSKAQLKASIKAIKEKSPKIFIAIDEEGGNVSRMKDKSFDGPYPSAYEVAST
LDIKSAYDLYSKMAINLKECGINLNFAPVVDLHDENSPIIAAKQRAFSEYASKVVIYADA
FMDAFKEQGILTTLKHFPGHGSSKEDSHKNKSEVTLSKDALLPYKDAISTGRAQIIMVGH
LFVKGIDDDNPATLSKKIITDLLRNELKFNGVVISDDMLMKGVGDEALAQKVVKFINAGG
DILLFSEFKINNQRTADLITQIIIDAVNEKKISKERIDASYKRIMALKAKL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagagcttttaaatttatactttttgttgctatttttgttttgggactaaacggcgct
gaggtgagcctaagagccaaggtctcgcagatgataatggttggctttaacggagctagc
acaaaagacgctgcgtttcgcgcgatgttaagcgacgctggatacgagagatttggcgga
gtgatgctacttggcagaaatgtcactagcaaagcccagctaaaagctagcataaaggct
atcaaagagaaaagtcctaaaattttcatcgctatcgacgaagagggcggcaacgtgagc
cgcatgaaggataagagctttgacggtccatatcctagcgcatacgaggtcgcaagcacg
cttgatatcaaaagcgcatacgatctctactcaaaaatggctataaatttaaaagagtgc
ggcataaatttaaattttgccccagtggttgatctgcacgatgaaaactcaccgatcatc
gccgctaagcaaagggcgtttagtgagtatgcgagcaaggttgtgatctacgctgatgct
tttatggacgcatttaaagagcagggcatcctaacgacacttaagcacttcccagggcat
ggcagctcaaaagaggactcacataaaaataagagcgaggtcacgctaagtaaagacgcg
ctactgccatacaaagacgccataagcactggtagagcgcagatcatcatggtcggacac
ctttttgtaaagggcatcgacgatgacaatccagccacactttctaaaaaaataataacc
gacctcttgcgaaatgagcttaaatttaatggtgtagtcattagcgatgatatgctgatg
aaaggcgttggcgacgaagctttagcgcaaaaagtggtgaaatttataaacgctggtggc
gacatcttgctctttagtgagtttaagataaataaccaaagaacggccgatctgatcact
cagatcataatcgatgctgtaaatgagaaaaagatcagcaaagagcgaatcgacgcttca
tacaagaggataatggctcttaaagcaaagctttaa

DBGET integrated database retrieval system