KEGG   Campylobacter concisus: CCC13826_0246Help
Entry
CCC13826_0246     CDS       T00593                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cco  Campylobacter concisus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCC13826_0246 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    CCC13826_0246 (dapE)
Enzymes [BR:cco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CCC13826_0246 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1656159..1657250)
Genome map
AA seq 363 aa AA seqDB search
MVVSFLKELLNFRSITPDDAGSLEFIAKFLPDFEAKFIEKNGTKNLILSKIYGDGEHLAF
AGHVDVVPPGDGWDSEPFTPLEKDGYIYARGSQDMKSGVAAFVCAAKEAKFEGKLSLILT
SDEEGDGTYGTPLALEYLREIRDLPKFCVVAEPTCDKKFGDSIKVGRRGSINGKIVIKGV
QGHVAYPEKCINPVNLIAPLLSKIADHDMDGGSEFFSPSKIVVTDIRGGMQVCNVTPSEL
SIMFNVRNSNLTDVNDVESYLRSVLDGLSYELSIKQSSKRFLTNKDSKIVRNLMASVTKI
TGVTPLLNTKGGTSDARHFAEFGVDAIEFGVINDRIHAKNERVSISEVNKLYEVFKDLIE
NFY
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtggtagttagctttttaaaagagcttttaaactttcgttctatcacgccagatgatgca
ggcagtttggaatttatcgctaaatttttgcctgattttgaggctaaatttatagaaaaa
aatggcacaaaaaatctcatactttctaaaatttatggagacggggagcatctagccttt
gcagggcatgtcgatgtcgtgccaccaggagatggctgggatagcgagccatttacccca
cttgaaaaagatggctacatctacgcaaggggttcgcaggatatgaaaagtggcgtggct
gcctttgtttgtgctgctaaagaggctaaatttgaaggcaaactaagcctcattttaaca
agtgacgaagagggcgatggcacttacggcacgcctttagcgcttgaatatctgcgtgag
ataagggatctgcccaaattttgcgtcgtggctgagccaacttgtgataagaaatttggc
gatagcataaaggtcggcagacgtggctcgataaatggtaagatcgtgataaagggcgtt
caaggacacgtggcatacccagaaaaatgcataaatccagtaaatttaatagctccactt
ttaagtaagatagctgaccatgatatggacggggggagtgagttttttagcccaagcaag
atcgtggtgacggacattcgtggtggcatgcaggtttgcaacgtcacgccaagcgagctt
agcataatgtttaacgttagaaactcaaatttaaccgatgtaaatgacgttgagagctat
cttagaagcgttttggatgggcttagttacgagcttagtataaagcaaagctcaaagaga
tttttaacgaacaaagatagcaagatcgtaagaaatttaatggcatctgtcacaaagatc
actggcgttacgccacttttaaatacaaagggcggcacgagtgacgctagacactttgct
gaatttggcgtagatgcgatagaatttggcgtcataaatgaccgcatacacgccaaaaac
gaacgtgtcagcatcagcgaagtaaataaactttacgaagtttttaaagaccttatagaa
aatttttactaa

DBGET integrated database retrieval system