KEGG   Campylobacter concisus 13826: CCC13826_0294Help
Entry
CCC13826_0294     CDS       T00593                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cco  Campylobacter concisus 13826
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1937084..1937734
Genome map
AA seq 216 aa AA seqDB search
MFRIEILTPLEAIKCQNLASDIADEITLSPLLFDAISTTEREIFVPIPAHAYKLDAQPIL
GNQWISSPLTVAKMTMALECENVDNILEIGCGSGYQAAILSKLAHRIFSVERIEKLAMEA
KKRFEALKIKNVHVRYDDGNNGWRSYAPFDRVLLSAAADEISPNLFSQLKNGGILVAPMK
KDGKQFIAKFRKDESGNLEKEFLDECLFVPLLEGRE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaggatagaaattttgaccccattagaagcgataaaatgccaaaatttagctagc
gacatagccgatgagatcacgctaagtccgcttttatttgacgcgatatcaacaactgag
cgtgaaattttcgtgcccatcccggcacatgcttacaagcttgacgcgcagccgatactg
ggcaaccaatggatcagctcgccactaacggtggcaaagatgaccatggcgctagagtgc
gaaaatgtggataacatcctagaaataggctgtggtagcggctatcaagcagcgatacta
agcaagctcgcacatagaatttttagcgtcgagcgcatagaaaagctagccatggaggcc
aaaaaacgcttcgaggcgctaaagatcaaaaacgtgcacgtaagatatgatgatggcaac
aacggctggcgaagctacgcgccgtttgatagggttttactctcggctgctgctgatgag
atctcgccaaatttatttagccagctaaaaaatggcggcatcttggttgctccgatgaaa
aaagatggcaagcagtttatcgctaaatttagaaaagacgagagtggaaatttagaaaaa
gagtttttagacgagtgcctttttgtgccacttcttgaaggcagagagtag

DBGET integrated database retrieval system