KEGG   Campylobacter concisus 13826: CCC13826_0294Help
Entry
CCC13826_0294     CDS       T00593                                 

Gene name
pcm
Definition
(GenBank) L-isoaspartate protein carboxylmethyltransferase, type II
  KO
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cco  Campylobacter concisus 13826
Brite
Enzymes [BR:cco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CCC13826_0294 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1937102..1937734
Genome map
AA seq 210 aa AA seqDB search
MTPLEAIKCQNLASDIADEITLSPLLFDAISTTEREIFVPIPAHAYKLDAQPILGNQWIS
SPLTVAKMTMALECENVDNILEIGCGSGYQAAILSKLAHRIFSVERIEKLAMEAKKRFEA
LKIKNVHVRYDDGNNGWRSYAPFDRVLLSAAADEISPNLFSQLKNGGILVAPMKKDGKQF
IAKFRKDESGNLEKEFLDECLFVPLLEGRE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
ttgaccccattagaagcgataaaatgccaaaatttagctagcgacatagccgatgagatc
acgctaagtccgcttttatttgacgcgatatcaacaactgagcgtgaaattttcgtgccc
atcccggcacatgcttacaagcttgacgcgcagccgatactgggcaaccaatggatcagc
tcgccactaacggtggcaaagatgaccatggcgctagagtgcgaaaatgtggataacatc
ctagaaataggctgtggtagcggctatcaagcagcgatactaagcaagctcgcacataga
atttttagcgtcgagcgcatagaaaagctagccatggaggccaaaaaacgcttcgaggcg
ctaaagatcaaaaacgtgcacgtaagatatgatgatggcaacaacggctggcgaagctac
gcgccgtttgatagggttttactctcggctgctgctgatgagatctcgccaaatttattt
agccagctaaaaaatggcggcatcttggttgctccgatgaaaaaagatggcaagcagttt
atcgctaaatttagaaaagacgagagtggaaatttagaaaaagagtttttagacgagtgc
ctttttgtgccacttcttgaaggcagagagtag

DBGET integrated database retrieval system