KEGG   Campylobacter concisus 13826: CCC13826_0429Help
Entry
CCC13826_0429     CDS       T00593                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cco  Campylobacter concisus 13826
Pathway
cco00040  Pentose and glucuronate interconversions
cco00052  Galactose metabolism
cco00500  Starch and sucrose metabolism
cco00520  Amino sugar and nucleotide sugar metabolism
cco01100  Metabolic pathways
cco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CCC13826_0429 (galU)
   00052 Galactose metabolism
    CCC13826_0429 (galU)
   00500 Starch and sucrose metabolism
    CCC13826_0429 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CCC13826_0429 (galU)
Enzymes [BR:cco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CCC13826_0429 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: EAT99239
UniProt: A7ZER5
Position
1434139..1434960
Genome map
AA seq 273 aa AA seqDB search
MIQTCLFPAAGYGTRFLPATKSLPKEMLPILTKPLIHYGVDEALEAGMDNMAFVTGRGKR
ALEDYFDISYELEKEIAGSSKESLLSEVRNLMSSCTFSFTRQNAMKGLGHAIYTGKTLVR
DEAFGVILADDLCINENGEGVLSQMVKIYEKYRCSVVAVMEVPKEQTKSYGVVSGRFIED
DLIMVDDMVEKPDPAEAPTNLAIIGRYILTPDIFNILERTKPGKNGEIQITDALKTQAKD
GMVLAYKFKGKRFDCGSIDGFVEATNFFYERSK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaacttgcctatttccagcggctggatatggaacgaggtttttaccagctaca
aaatcgctcccaaaagagatgctaccgatccttacaaaaccgctcattcactacggcgtt
gatgaggcacttgaggctggcatggacaatatggcctttgtcacaggacgcggaaaaagg
gcgcttgaggactattttgacattagctacgagctagaaaaagagatcgcaggcagctca
aaagagtcactacttagcgaagttagaaatttaatgagttcatgcacattttcatttact
aggcaaaatgccatgaaagggcttggacacgccatttatacgggcaaaactctagttcga
gatgaagcctttggggtcattttggcagatgatttatgtataaatgaaaacggcgagggc
gtgctttcgcagatggttaaaatttatgaaaagtatcgctgcagcgtcgttgctgtgatg
gaggtgccaaaagagcagaccaagtcttacggcgtcgtaagcggtaggtttatagaagat
gatctcataatggtcgatgatatggttgaaaagcctgatcctgctgaggctccgacaaat
ttagcgataattggtcgctacatcctaacgccagatatttttaacatcttagagcgaaca
aagccaggcaaaaacggcgaaatccagatcacagatgcgctaaaaacgcaggcaaaagat
ggcatggtgctagcttataaatttaagggcaagaggtttgactgcggtagcatcgatggc
tttgtcgaggctacaaatttcttttacgagcgcagtaaatga

DBGET integrated database retrieval system