KEGG   Campylobacter concisus: CCC13826_0429Help
Entry
CCC13826_0429     CDS       T00593                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cco  Campylobacter concisus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CCC13826_0429 (galU)
   00052 Galactose metabolism
    CCC13826_0429 (galU)
   00500 Starch and sucrose metabolism
    CCC13826_0429 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CCC13826_0429 (galU)
Enzymes [BR:cco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CCC13826_0429 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1434139..1434960
Genome map
AA seq 273 aa AA seqDB search
MIQTCLFPAAGYGTRFLPATKSLPKEMLPILTKPLIHYGVDEALEAGMDNMAFVTGRGKR
ALEDYFDISYELEKEIAGSSKESLLSEVRNLMSSCTFSFTRQNAMKGLGHAIYTGKTLVR
DEAFGVILADDLCINENGEGVLSQMVKIYEKYRCSVVAVMEVPKEQTKSYGVVSGRFIED
DLIMVDDMVEKPDPAEAPTNLAIIGRYILTPDIFNILERTKPGKNGEIQITDALKTQAKD
GMVLAYKFKGKRFDCGSIDGFVEATNFFYERSK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaacttgcctatttccagcggctggatatggaacgaggtttttaccagctaca
aaatcgctcccaaaagagatgctaccgatccttacaaaaccgctcattcactacggcgtt
gatgaggcacttgaggctggcatggacaatatggcctttgtcacaggacgcggaaaaagg
gcgcttgaggactattttgacattagctacgagctagaaaaagagatcgcaggcagctca
aaagagtcactacttagcgaagttagaaatttaatgagttcatgcacattttcatttact
aggcaaaatgccatgaaagggcttggacacgccatttatacgggcaaaactctagttcga
gatgaagcctttggggtcattttggcagatgatttatgtataaatgaaaacggcgagggc
gtgctttcgcagatggttaaaatttatgaaaagtatcgctgcagcgtcgttgctgtgatg
gaggtgccaaaagagcagaccaagtcttacggcgtcgtaagcggtaggtttatagaagat
gatctcataatggtcgatgatatggttgaaaagcctgatcctgctgaggctccgacaaat
ttagcgataattggtcgctacatcctaacgccagatatttttaacatcttagagcgaaca
aagccaggcaaaaacggcgaaatccagatcacagatgcgctaaaaacgcaggcaaaagat
ggcatggtgctagcttataaatttaagggcaagaggtttgactgcggtagcatcgatggc
tttgtcgaggctacaaatttcttttacgagcgcagtaaatga

DBGET integrated database retrieval system