KEGG   Campylobacter concisus 13826: CCC13826_0524Help
Entry
CCC13826_0524     CDS       T00593                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cco  Campylobacter concisus 13826
Pathway
cco00250  Alanine, aspartate and glutamate metabolism
cco01100  Metabolic pathways
cco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cco00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CCC13826_0524
Enzymes [BR:cco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CCC13826_0524
Peptidases [BR:cco01002]
 Cysteine Peptidases
  Family C44
   CCC13826_0524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase DUF3700 tRNA_Me_trans DUF1933
Motif
Other DBs
NCBI-ProteinID: EAT99214
UniProt: A7ZF04
Position
complement(1533511..1535340)
Genome map
AA seq 609 aa AA seqDB search
MCGISGIINKSNVAVAKDEIKNMNDLIVHRGPDDEGFFYGKNFALGHRRLSILDLSKDGH
QPMSYMEDKYTITYNGEIFNYLEIKKKLEEFGYKFNSKTDTEVILASYDRWGKDCVEKFN
GMWAFAIYDKKEDILFCSRDRFGVKPFYFTQTKDKFVFGSEIKQLLNFCNGKFVNKTLLI
DFLATGMLEHTNETFFEGIYKLEQAHNMIYDLKTHNFKIKKYYDMALNENNKKLDEIQSI
DSVSKNLKQAIKLRLRSDVKVGTCLSGGLDSSSVAALASMAYTNNEEKFIAIHAKSIEES
TDESIYAQMVAQHCDLNLQIVEPSTQKFIDNIQEVVYTQEEPFGGPSIFMQYFVMQKAKD
LNCKVMLDGQGGDETLLGYEKYYPAIYLDMFKNFGLMYCLKEVMRSNKNNSKLSLFGILK
YIVGSLFFGIRKIYIKRNVSFLKAFENKFLFLENLSKKYFNIDEMQKYEIFTTNLPALLR
YEDKNSMRHSIETRLPFVDYVNLENSLSINAKYKIKDGWSKYVLRKVIDSILPNEVVWRK
NKFGFNAPDNIWLNSIKDKMKEDILSSNIIKSVADMKHLKFKLNSMNILIMWRLYCVSVW
ERVYDVHAK
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaataagtggaataatcaataagagcaatgttgccgtggcaaaagatgaaata
aaaaatatgaatgatttgatagttcatagaggaccagacgatgagggctttttttatggt
aaaaattttgcattaggacatagaagactatctatcttggatcttagcaaagatggtcat
cagcctatgagctatatggaagataaatatacaataacatataacggtgaaatttttaat
tatttagagataaaaaaaaagcttgaagaatttggatataaatttaactcaaaaactgat
accgaagttattttagcaagctatgatcgatggggcaaagattgtgtcgaaaaatttaat
ggaatgtgggcttttgcaatatatgacaaaaaagaagatatattgttttgttcaagagat
agatttggggtaaagccattttattttacacagacaaaagacaaatttgtatttggctcc
gagataaaacaacttttaaatttctgcaatggtaaatttgtaaacaagaccttgctaatt
gattttttggctaccggtatgctagaacatactaatgaaacattttttgaaggtatctat
aagctagagcaagctcataatatgatttatgatttaaaaactcataattttaaaattaaa
aagtattacgatatggcattaaatgaaaataataaaaaattagatgaaattcaaagcata
gattcggtttcaaaaaatttaaaacaagcaattaagttgaggttgagatcggacgttaaa
gtcggaacttgtcttagcggggggcttgatagctcgagtgtggcagcgcttgcttctatg
gcatataccaataatgaggaaaaatttatagccattcatgcaaaatcaatagaggaaagt
acagatgaaagtatatatgcacaaatggtggcgcagcattgcgacttaaatttacaaata
gtggagccaagtacacaaaaatttattgataacatacaggaagttgtttatacgcaagag
gaaccatttggtggcccatctatttttatgcagtattttgttatgcaaaaagcaaaggat
ttaaactgtaaagttatgttggatggccaaggtggtgatgagactctacttggatatgaa
aagtattatccagcaatttatttagacatgtttaaaaattttggcttaatgtactgttta
aaagaggtaatgaggtcaaataaaaataactcaaaattgagtttatttggaatattgaaa
tatatagttggaagtttattttttgggataagaaaaatttacattaaaagaaatgttagt
tttttaaaagcttttgaaaataaatttttattcttggaaaatttgtcaaaaaaatatttc
aatatagatgaaatgcaaaaatatgaaatttttaccacaaatttaccagcgcttttgaga
tatgaggataaaaactcaatgaggcactctatcgaaaccagactcccatttgtagattat
gtaaatttagaaaattctctgagcataaatgcaaaatataaaattaaagatggttggagt
aaatatgtcttaagaaaggtcattgatagcattttgccaaatgaagtagtttggcgaaaa
aataaatttggttttaatgcacctgataatatttggttaaatagcatcaaagataaaatg
aaagaggatatattaagctctaatattattaagtctgttgccgatatgaagcatttaaaa
tttaagcttaatagcatgaacatactcataatgtggcgtctttattgtgtgagtgtttgg
gagagagtttatgatgttcatgcaaagtag

DBGET integrated database retrieval system