KEGG   Campylobacter concisus 13826: CCC13826_0545Help
Entry
CCC13826_0545     CDS       T00593                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cco  Campylobacter concisus 13826
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cco00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1556137..1556748)
Genome map
AA seq 203 aa AA seqDB search
MQGQILVVSGPSGSGKSTLLGRLLKEEKDLYFSISSTTRAKREGEVDGVDYYFIGEDEFK
SGIEKGEFLEWAQVHKNYYGTSLKPVLAALEAGKIVIFDIDVQGFHIALEKFKSYITSVF
ITTANKKELKRRLKNRGTDSDETIENRLMNAVGEMEHILEYDYFLVNDDIEKSYKGLKSI
LRAMRLKSAKINLRNVIDEWIDC
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaggacaaattttagtagtttcgggacctagtggaagcggtaaaagcacgcttttg
ggccgtcttttaaaggaggagaaagacctatatttttctatctcaagcacaacaagagcc
aaaagagaaggcgaagttgatggggtggattactattttattggagaggatgaatttaaa
agcggcatcgaaaagggcgagtttttagagtgggcgcaggtgcataaaaactactatggt
acgagcttaaagccagtcttagcagcacttgaagctggaaagatagtgatatttgacatc
gatgtgcagggctttcacatcgcacttgagaaatttaaaagctacatcacttcagttttt
atcacaactgcgaataaaaaagagctaaaaaggcgcttgaaaaaccgcggaacagatagc
gatgaaacgatagaaaatcgcctaatgaacgcagttggtgagatggagcacattttagag
tatgattattttttagtaaatgatgatatagaaaagagctataaagggctaaaatcaatc
ctccgggcgatgaggttaaaaagcgctaagataaatttaagaaacgtcatcgacgagtgg
atagattgttag

DBGET integrated database retrieval system