KEGG   Campylobacter concisus: CCC13826_0666Help
Entry
CCC13826_0666     CDS       T00593                                 

Definition
integral membrane protein
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cco  Campylobacter concisus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCC13826_0666
   00030 Pentose phosphate pathway
    CCC13826_0666
   00051 Fructose and mannose metabolism
    CCC13826_0666
   00052 Galactose metabolism
    CCC13826_0666
   00500 Starch and sucrose metabolism
    CCC13826_0666
   00520 Amino sugar and nucleotide sugar metabolism
    CCC13826_0666
  Nucleotide metabolism
   00230 Purine metabolism
    CCC13826_0666
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CCC13826_0666
Enzymes [BR:cco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CCC13826_0666
    5.4.2.8  phosphomannomutase
     CCC13826_0666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
749433..750800
Genome map
AA seq 455 aa AA seqDB search
MKYDEIFREYDIRGIFEKDLTEDSVKAIGLALGKKFNEFGVKTLSVGFDARLSASTLFRY
LLSGLNKAGGFKIYNIGLLPTPVGYFSVYADYFDANIMITGSHNPKDYNGFKITIKKDSF
FGKDLQILKDKVNEIIASNLEIADDESCEKFNILEKYVGFFVKEFSELKNFKKPFVIDCA
NGAVGVSLVPIVKALGLNAKILYEEPNGNFPNHHPDPSEKENLKELFSLIEKKEFDLGFG
FDGDGDRIAVITPKRDIKGDELAYLYALNMKHPKVLGEVKCSQNMYDEIAKIGEVFMGKT
GHSNIKKMMKELNVDLAAEVSGHIFFKERYFGFDDALYAMMRVLELVHKGFDLDGELDKM
PLVFSTDEIKIKTTDEAKFKIVAKLKECVKNDSCDLPKIKNIIDIDGIRIQFENGWALVR
ASNTTPVIVTRFEAKSKEFLEEIEQKVTNLLKSLM
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgatgaaatttttagagaatacgacatccgtggcatttttgaaaaagacttg
acagaggacagtgtcaaggctatagggcttgctttgggtaagaaatttaacgaatttggc
gtgaaaactttaagcgttggctttgacgcaaggctaagtgctagcacactttttaggtat
ctgctaagcggtctaaacaaggctggtggctttaaaatttataacatcggcttgctacca
actcctgttggctactttagcgtttatgctgattattttgatgcaaacatcatgatcacg
ggctctcacaacccaaaagattataacggctttaagatcaccattaaaaaagatagcttc
tttggcaaagatctgcaaattttaaaagacaaagttaatgagataatcgcctcaaattta
gagatcgcagacgatgagagctgtgagaaatttaatatcttagaaaaatatgttgggttt
tttgtaaaagaatttagtgagcttaaaaatttcaaaaagccttttgtcatagactgcgca
aatggcgctgttggcgtgagcttggtgcctatcgtcaaggcgcttgggctaaatgcgaaa
attttatatgaagagccaaacggaaattttccaaatcaccacccagacccaagcgagaaa
gagaatttaaaagagctgttttcgctcatcgaaaagaaggaatttgaccttggatttggc
tttgacggagatggcgataggatcgccgtgataactccaaaaagagatataaaaggcgat
gagctagcatatctttatgcgctaaatatgaaacatccaaaagtgcttggcgaggtaaaa
tgctcacaaaatatgtatgatgaaatcgccaagatcggcgaagttttcatgggcaagact
ggacacagcaacatcaaaaaaatgatgaaagagctaaacgtagatctcgcggctgaagtg
agcggtcatatcttctttaaagagcgatactttggctttgatgatgcgctttatgcgatg
atgagagtgcttgagctagttcataagggctttgatcttgacggcgagcttgataagatg
ccgcttgtctttagcaccgatgagatcaagataaagacgactgacgaggctaaatttaag
atagttgccaagctaaaagagtgcgtgaaaaacgatagttgcgacctgccaaagataaaa
aatatcatcgacattgatggcattaggattcagtttgaaaatggctgggcgctggtgcgt
gcgtcaaatacaacgccagttatcgttactagatttgaagctaaaagcaaggaattctta
gaagagatcgagcaaaaagtgacaaatttgctaaagagcttaatgtag

DBGET integrated database retrieval system