KEGG   Campylobacter concisus: CCC13826_0758Help
Entry
CCC13826_0758     CDS       T00593                                 

Gene name
tpx
Definition
thiol peroxidase (EC:1.11.1.-)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cco  Campylobacter concisus
Brite
Enzymes [BR:cco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CCC13826_0758 (tpx)
Secretion system [BR:cco02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   CCC13826_0758 (tpx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
300566..301273
Genome map
AA seq 235 aa AA seqDB search
MKKVILASIIAATSLMAASDKQIEDFYSQMVDSSVKVKVADRHKVAGDIEAVVVKLSKDG
NSQDEIVFTIGDFIFPDVIDLKEQKSYLAEVKKEVIAKGISKIYKDEDKANIIVLGSDPK
KPTIIMFSDPECPYCRAELAKIETTLKDSNVEIVLTPVHDVSSLQKSSLIYKDAKAAKSD
SDKVKILRKYYAEDYNVDDKSVSKEDVAKIDNLRKKYFAAGVRSVPFIVNKSDLK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtgatcttagcctcaatcatcgcggcaactagcctaatggcagcaagcgat
aagcaaatagaggacttctactctcaaatggttgatagtagcgtaaaagtaaaggtagct
gatcgtcacaaagtggcaggcgatatcgaagctgtcgtggtaaaactaagcaaagatggc
aactcacaagatgagatagtttttacaataggtgacttcatcttcccagacgtgatcgat
ctaaaagagcaaaaatcataccttgctgaagtgaaaaaagaggtcatcgcaaagggaatt
tctaaaatttataaagatgaggacaaggcaaacatcatcgttcttggtagtgaccctaaa
aagccaactatcataatgttttcagacccagagtgcccatactgcagagctgagctagca
aagatcgagacaacgctaaaagatagcaacgttgagatcgtcctaactccagtacatgat
gtctcatcacttcaaaaaagctcactaatctacaaagatgcaaaagctgctaagagtgac
agtgataaggttaaaattttaagaaaatactacgctgaagactacaatgtagatgataag
agcgttagtaaagaagatgtcgcaaagatcgataatctacgcaaaaaatattttgcagct
ggcgttagatcagtgccatttatcgtaaataaaagcgatctaaaataa

DBGET integrated database retrieval system