KEGG   Campylobacter concisus: CCC13826_0841Help
Entry
CCC13826_0841     CDS       T00593                                 

Gene name
cheB
Definition
protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cco  Campylobacter concisus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CCC13826_0841 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CCC13826_0841 (cheB)
Enzymes [BR:cco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CCC13826_0841 (cheB)
Two-component system [BR:cco02022]
 CheA family
  CheA-CheYBV
   CCC13826_0841 (cheB)
Bacterial motility proteins [BR:cco02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CCC13826_0841 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
606282..606848
Genome map
AA seq 188 aa AA seqDB search
MAQKLVLIGASTGGPGHIKKLLKDINLNGAMVVIAQHMNKMFINSFVTQMGRECNINVEI
LSEKTNLRENIVYICDQNFEISATLPVSAKPQPEIKTIYTPNVDVLFNSGTQIAKNVNLL
AILLTGIGDDGAAGLDKLYKAGAKCVAENEESAIVYGMPKRAKELNQNLKSLNLMMIRKE
LEEFLNAF
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaaaaactggtcttaataggggcttctacaggaggcccaggtcatataaaaaaa
ctattaaaagatataaatttaaatggtgcaatggtcgtcatcgctcagcatatgaataag
atgtttataaactcatttgtcacgcaaatgggcagggagtgcaacataaatgttgaaatt
ttaagcgaaaagacaaatttaagagaaaatatcgtctatatctgtgatcaaaattttgaa
atttcagcgactttgccagttagcgcaaagccacaacctgagataaaaacgatatatacg
ccaaatgttgatgtgctttttaactcaggcacgcagatcgccaaaaatgtaaatttactt
gcgatcttgctaactggcatcggcgatgatggtgcagctgggcttgataagctctataaa
gctggcgcaaaatgcgtagctgaaaatgaagagagcgccatagtttatggcatgccaaag
cgtgctaaggagctaaatcaaaatttaaaatcgttaaatttaatgatgataagaaaagag
cttgaggagtttttaaatgctttttaa

DBGET integrated database retrieval system