KEGG   Campylobacter concisus 13826: CCC13826_0968Help
Entry
CCC13826_0968     CDS       T00593                                 

Gene name
recR
Definition
(GenBank) recombination protein
  KO
K06187  recombination protein RecR
Organism
cco  Campylobacter concisus 13826
Pathway
cco03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cco00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CCC13826_0968 (recR)
DNA repair and recombination proteins [BR:cco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     CCC13826_0968 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CCC13826_0968 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecR Toprim_4 zn-ribbon_14 HHH HHH_5 Chal_sti_synt_C
Motif
Other DBs
NCBI-ProteinID: EAT98230
UniProt: A7ZBY4
Position
396693..397265
Genome map
AA seq 190 aa AA seqDB search
MKRGLEKFNELTESFAKLPGVGKKSAARFAYFVCMQDSFAGLRLAQNIEDAVRFIKRCER
CGGLSENEICDICSDESRDSEVILLVESPKDILVFEQNGIYNGLYFVLDEIDDDTIERLR
SAIKQNGSKEVVFAFTPGLNSDALMLYVEDKLGMSEISFSKIAQGVPTGVNLENVDMLSL
LKAYESRTKA
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggggcttagagaaatttaacgagctaactgagtcatttgctaagctaccaggt
gtgggaaaaaaatcagccgcaagatttgcctactttgtctgcatgcaagatagctttgca
gggctaaggctagcgcaaaatatcgaagatgcagtgaggtttatcaagcgttgtgagcgt
tgtggcgggttaagcgaaaatgaaatttgcgacatttgcagtgacgagagtagagatagc
gaggtcatattgctggttgagagcccaaaagatatcttagtctttgagcaaaatggcatc
tacaatggcctttacttcgtgcttgacgagatcgatgatgacaccatagagaggctgcga
agtgctatcaagcaaaatggctcaaaagaggtcgtctttgcctttacaccggggctaaat
tcagacgctcttatgctttacgtcgaggacaagcttggcatgagtgaaatttcatttagc
aagatcgctcagggcgtgccaactggcgtaaatttagaaaatgtcgatatgctctcactc
ttaaaagcctacgagagccgcacaaaagcctaa

DBGET integrated database retrieval system