KEGG   Campylobacter concisus 13826: CCC13826_0972Help
Entry
CCC13826_0972     CDS       T00593                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cco  Campylobacter concisus 13826
Pathway
cco00260  Glycine, serine and threonine metabolism
cco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cco01100  Metabolic pathways
cco01110  Biosynthesis of secondary metabolites
cco01130  Biosynthesis of antibiotics
cco01230  Biosynthesis of amino acids
Module
cco_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cco00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCC13826_0972 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCC13826_0972 (trpB)
Enzymes [BR:cco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CCC13826_0972 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ACOX Nuc_recep-AF1
Motif
Other DBs
NCBI-ProteinID: EAT98238
UniProt: A7ZBY7
Position
399556..400737
Genome map
AA seq 393 aa AA seqDB search
MNTKAYFGKFGGQFVPETVMFALDELENAYESIAKTKEFKDELNDLLKNYVGRPSPLFFA
KRLSEHYGHEIYLKREDLNHTGAHKINNALAQSLLAKKMGKKKILAETGAGQHGVATATA
AALLGLECDVYMGATDVARQQLNAFRMQLLGAKVVSVEDGLKTLKEATTAAIQAWVNEIE
SAFYVIGSAVGPHPYPKIVRDFQSVIGTEAKAQLADYGKKADYVIACVGGGSNAIGIFSA
FLDDKSVNLVGIEAGGLGIDTPYHAATLSKGKTGIIHGMKTTVLQDEYGMISPVHSISAG
LDYPGIGPEHAHLNDIKRVKYEAVTDDECINALYFLSKMEGIIPAIESAHAVAYLEKLCP
KLEKKSVIVVNVSGRGDKDINTVIGYEKGKIYG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaatactaaggcgtattttggaaaatttggcgggcagtttgtgcctgagacggtgatg
tttgcccttgatgagctagaaaatgcttatgagagcatcgcaaagacaaaagagtttaaa
gacgagcttaatgatcttttgaaaaactacgttggcaggcctagtccgctcttttttgca
aagcgcctaagcgagcactacggacatgaaatttacctcaagcgtgaggatctaaaccac
acgggcgcgcacaagataaataatgctctagctcaatcgctgcttgccaaaaagatgggt
aaaaagaaaattttagctgagactggagctggccagcacggcgtggcaacagcgactgca
gcggcacttttgggcttagagtgtgatgtctatatgggcgcaacagacgttgctagacag
cagctaaatgcctttcgtatgcagcttcttggcgcaaaggtggtgagcgtagaagatggc
ttaaaaacgctaaaagaggcgactacagcagccatacaagcgtgggtaaatgagatagaa
agcgcattttacgtcatcggctcagccgttggcccgcacccatatccaaagatcgtgcgt
gactttcaaagcgtgattggcacagaggccaaagcccagcttgcagactacggcaaaaag
gccgactacgtcatcgcctgcgttggcggcggcagtaatgctattggcatttttagcgcg
ttcttggacgataagagcgtaaatttagtaggtatagaagctggcgggcttggcatagat
acgccttatcacgcagctacgcttagcaaaggcaaaactggcatcatccacggcatgaaa
acgacggtcttgcaagatgaatacggcatgatctcgccagtacatagcatctcagcaggc
cttgactacccaggcatcgggccagagcacgcccacttaaacgatatcaaaagggtaaaa
tacgaagccgtgaccgacgatgagtgcataaatgccctgtattttctaagcaagatggag
ggcatcatcccagccatcgagagcgcgcacgcggtggcatatctggagaaactttgccca
aaactagagaaaaaaagcgttatcgtcgtaaatgtctcaggcaggggcgataaggacata
aacacagttatcggctacgaaaaaggaaaaatttatggataa

DBGET integrated database retrieval system