KEGG   Campylobacter concisus 13826: CCC13826_0973Help
Entry
CCC13826_0973     CDS       T00593                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cco  Campylobacter concisus 13826
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCC13826_0973 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCC13826_0973 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCC13826_0973 (trpA)
Enzymes [BR:cco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CCC13826_0973 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
400730..401479
Genome map
AA seq 249 aa AA seqDB search
MDKVRSAFNGKKANIGYIVAGYPSLEKTKEFLENLDESTLDLLEIGIPYSDPLADGKLIA
QASFETVQNGVNTDVVFDMLEGCKAKVTKPLVFLVYYNIIFAYGVDKFLKRSREAGVSGF
IVPDLPCEECEEFALKCKELNLCLVPLISVTSGGRADEILKFGSGFIYVLGAIGVSGSKR
ADEDRIKNLVLELKKKSDLPVAVGFGIKNKDDVNEVKKYADAAIIGTQIVKLCAKFSAKE
LVKEVDKLF
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggataaggttagaagcgcatttaacggcaaaaaggcaaacatcggctacatcgtggct
ggatatccaagcttagaaaaaacgaaggaatttttagaaaatttagatgagagcacgctt
gatctgctagagatcggcatcccatactctgacccgctggctgatggcaaactcatcgcg
caagctagctttgagacagtgcaaaatggtgtaaacactgacgttgtctttgatatgctt
gagggttgcaaggcaaaagtgacaaagccacttgtttttctagtttattacaacattatc
tttgcttatggcgttgataaatttctaaaaagatcacgtgaagcaggagttagcggcttt
atcgtgccggatctgccttgtgaggagtgcgaggagtttgctctaaagtgcaaggagcta
aatttatgccttgtgccacttataagtgtcacgtctgggggcagggcggatgagatatta
aaatttggctcaggatttatctacgtgctaggtgctatcggcgttagcggttcaaaaaga
gccgatgaagataggataaaaaatttagtcctagagcttaagaaaaagagcgatctgcca
gtggctgtgggctttggcatcaaaaataaagatgatgttaatgaagtgaaaaaatatgct
gacgctgcgatcataggcacgcaaatagtcaagctttgcgctaaatttagcgcaaaagag
ctagtgaaagaggtcgataaactcttttaa

DBGET integrated database retrieval system