KEGG   Campylobacter concisus: CCC13826_1084Help
Entry
CCC13826_1084     CDS       T00593                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cco  Campylobacter concisus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cco00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CCC13826_1084
Enzymes [BR:cco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CCC13826_1084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(802102..802689)
Genome map
AA seq 195 aa AA seqDB search
MDLLHSTNEIKKISLSMFRKNFFGVFHGSISARVEKNQFIINKQSAIFDDLQDSDLTLLS
SKKDYRWNDASLDADIHLNIYKNINEAKFVCYAMPPYVTAYAMKHEKIAPKDYFGCMRFN
EILVYDPKQFDDWYERAETEIYRAMIEKNTNVVVIKGYGVYAYSRSPQLLAKDIALLENS
CKLLHFTGDYSDFSI
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggacttattgcactcaacaaatgagataaaaaagatatctctttcgatgtttagaaag
aatttttttggtgtttttcatggttctatctcggcaagagtagaaaaaaatcaattcatc
atcaacaagcaaagtgccatttttgacgacttgcaagatagtgatctaacacttctttca
tcaaaaaaagactaccgctggaatgatgcaagcttagatgctgatatacacttaaatatc
tacaaaaacataaatgaagcaaaatttgtctgctacgccatgcctccatacgtgacagct
tatgcaatgaaacatgaaaagatcgcaccaaaagactattttggatgcatgagatttaat
gaaattttagtctatgatccaaagcagtttgacgactggtatgagcgtgctgagacagaa
atttatagagcgatgatagagaaaaatactaacgtcgtcgtgatcaaaggatacggcgtt
tacgcgtatagcaggagccctcagctacttgcaaaagatatagctttgttagaaaatagc
tgcaaactgcttcattttactggtgattacagcgattttagcatttaa

DBGET integrated database retrieval system