KEGG   Campylobacter concisus: CCC13826_1108Help
Entry
CCC13826_1108     CDS       T00593                                 

Definition
cytochrome C551 peroxidase (cytochrome Cperoxidase; CCP) (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cco  Campylobacter concisus
Brite
Enzymes [BR:cco01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CCC13826_1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(74954..75817)
Genome map
AA seq 287 aa AA seqDB search
MKKVLFWMVVSFCILSANSSFEPVLSSKYNEKQAYIGKKLFFDKRLSTTENYSCETCHNL
YWNLSGTNSSYTSQKGVINPPSVLNSALNFLFFTDGRVRSLKDQVKESINSRNELNSNKD
EIVKKVKSIGEYGILFNDAYSDGINYENIVGALAEFEKAILSIDSPFDEYLAGNDDSINA
EAKKGFELFNKVGCVACHNGRNLGGNLMQNVGLKDASESRRLMRVPSLRNVARTAPYLSS
GEMSDLKEVIGFVSYHQLIHTLSSEELEQIYKFLQTLNGRRPRILNE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttttattttggatggtagtatctttttgcattttgagcgcaaattcatca
tttgagccagtgctttcatcaaaatataacgaaaaacaagcctacatcggtaagaagctc
ttttttgacaaaagactaagcaccactgaaaactactcatgcgaaacttgccacaactta
tactggaatttaagtggcacaaactcatcttacaccagccaaaagggcgttataaaccca
cctagcgtgctaaattcggctttaaattttctattttttactgatggcagggtaagaagc
ttaaaagatcaagtaaaagagtcgataaattctagaaatgagctaaattcaaacaaagat
gagatagtaaaaaaagtaaaaagcataggcgagtatgggattttatttaatgatgcatat
agtgatggcataaactatgaaaatatagtaggtgctttggcagaatttgaaaaggctatt
ttaagcatagattcgccatttgatgagtatctagctggcaatgacgactccataaacgct
gaggcaaaaaagggctttgagctctttaataaagtaggctgtgtggcttgccataatggt
agaaatttaggtggaaatttgatgcaaaacgtgggcttaaaggatgctagtgagagcaga
cgcctcatgcgcgtgccttcgcttagaaatgtagcaagaacggctccatatctaagcagt
ggcgaaatgagcgatctaaaagaggtcataggctttgtgagctatcatcagctgatccac
acactaagtagcgaagagctggagcaaatttataaatttttgcaaacactaaatggacgc
agacctaggatactaaatgaataa

DBGET integrated database retrieval system