KEGG   Campylobacter concisus: CCC13826_1453Help
Entry
CCC13826_1453     CDS       T00593                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cco  Campylobacter concisus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCC13826_1453
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCC13826_1453
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CCC13826_1453
Enzymes [BR:cco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CCC13826_1453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1169935..1171020
Genome map
AA seq 361 aa AA seqDB search
MPKFICSKCGKSADFETPIFACECGGLYDLEFKAAKFDLNLIDQREFSLFRYREFFPIKN
ELWRDISLGEGLTKSVKFDVSLYLKMDYAMPTLSFKDRGAVMLIWFCKTHGIKKILQDSS
GNAGNSVAAYAARAGIECEIYVPKGTSEKKIKMLEYYGAKAVVFDGTRDETADACRKRAK
DEGIFYANHVFNPLFYQGTKTYIYEIYEQLGFVPENLFLPVGNGTLLIGCEIALNELYEA
GVIKKLPKIFIVQSEKCAPFLGVTSEPLAIKPEPTLAEGIAIAKPARGAEILASSYAGER
EVITIKEEDIEPARNFLASRGFYVEHTTAAIYAAYASYAKSHKIEGKSIISMCGAGLKSE
H
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaatttatctgctcaaagtgcggcaagagcgcagattttgaaacgcctatattt
gcgtgcgagtgcggtgggctatatgatctggagtttaaagcagccaaatttgatctaaat
ttgatcgatcagcgcgagtttagcctctttagataccgcgagttttttcctatcaaaaac
gagctttggcgcgatatcagccttggcgaagggctaacaaagagcgtgaaatttgatgtc
tcactctaccttaaaatggactatgcaatgccaacgctttcgtttaaagataggggtgcg
gtgatgcttatttggttttgtaaaactcatggcatcaaaaagatcttgcaagatagcagc
ggaaacgctggtaactcggtcgctgcatacgctgctagagctggcatagagtgtgaaatt
tacgtcccaaaaggcacaagtgagaaaaagataaagatgcttgagtactacggcgcaaag
gcggttgtctttgacggcacgcgcgatgagacggcggatgcttgtagaaaaagagcaaaa
gatgagggaattttttacgcaaaccacgtatttaacccgcttttttaccaaggcaccaaa
acatatatatatgaaatttacgagcagcttggctttgtccctgaaaatctctttttacca
gttggcaacggcaccttgctaattggctgcgagatagcgctaaatgagctatatgaggct
ggagttatcaaaaaactacctaaaattttcatcgttcaaagtgaaaagtgcgcgccattt
ttaggggtaacaagcgagccacttgcgatcaagccagagccaactttggctgaaggcata
gcgatagcaaaacctgctcgtggcgctgagatattagctagcagttacgcaggagaacgc
gaagtgatcacgataaaagaagaggatattgagccagctagaaatttcctagcaagccgc
ggtttttacgtcgagcacaccacagcagcgatctacgcggcatacgcaagctacgcaaaa
tcgcacaagatagagggcaaaagtatcatctcgatgtgcggcgctgggctaaaaagcgag
cattaa

DBGET integrated database retrieval system