KEGG   Campylobacter concisus: CCC13826_1729Help
Entry
CCC13826_1729     CDS       T00593                                 

Definition
methyl-accepting chemotaxis protein
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
cco  Campylobacter concisus
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cco00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    CCC13826_1729
Enzymes [BR:cco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     CCC13826_1729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1867869..1870457)
Genome map
AA seq 862 aa AA seqDB search
MQKLFCVASAALLGLSLTAACAASSDLEKVMKERGLSEKDVLAAAKTYQPSGKKDDFIVF
SSGGQSGQVLVYGVPSMRIYKYIGVFTPEPWQGYGYDNESKAVLKQGNIRGKEITWGDTH
HPNFTEKNGEYVGDYLFINDKANPRIAVINLKDFETTQMVVNPIMKSEHGGSFITPNSEY
VIEASQYAAPLDDNYHSMDDYEAVYRGAVTFWKFDYPKGKIDEKASFSLELPPYWQDLSD
AGKGESYGWGFTNSINTEMYTGGIEKGLPPFEAGASRNDTDFLHVYNWQILEKLAQDKKN
YKVINGHRVITIEAAVKAGALFLIPESKSPHGCDVTPDGRYIIVGGKLDTHASVYDFKKI
KELIDKKEFAGTDPYGIPILDREKSMHGQVELGLGPLHTSFDSQDGILYTSLYVDSQIVK
WDYKNLKVLDKVNVHYNIGHLDTMEGKSAKPKGKYAIALDKLSIDRFNPVGPLHPQNHQL
IDITGAKMDLIYDMPIPLGEPHDVVSIAASKLTPALTYNMGTNSRTGEASPYATLAGQER
VERNGKNVTVYATMIRSHINPEHIEVNKGDNVTIHLTNLERAQDETHGFGIDLYNIHASL
EPGKTASVNFVADMEGVFPYYCTEFCSALHLEMMGYLLVKDPNKKYESAKNSKLKTLSPE
ALKAEYDKVIATNKATDDVIQEVVKYLKEKHYEKYPKVKALVDDALDQYGHIKEVKAKAD
EAYKKGDVNGAILWEYQVWQYMVKTADVGLRAKNNLAKEIATPMSPAAAKGEEAYLKGGC
NGCHVIGQVSSGPDLTGVLLRHENGEKWVADFIKDPAKFYNDDYVKAMIDFFKLRMPNQH
MSDEEIKNIIQYLKWIDENAGM
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagttattttgtgtcgcaagtgctgcactgcttgggctatctttaactgctgct
tgtgctgctagtagtgaccttgaaaaagtcatgaaagagcgcgggctaagcgaaaaagat
gtccttgcagctgctaagacttaccagccaagcggtaaaaaagatgatttcatcgtcttt
tcatctggcgggcagagtggtcaagtgctagtttatggcgttccgtcgatgagaatttac
aaatacatcggcgttttcaccccagagccttggcaaggatatggctatgacaatgagtca
aaagccgttttaaaacaaggcaacatcaggggcaaagagataacttggggcgatacacac
cacccaaatttcactgagaaaaatggtgagtatgttggtgattatctatttatcaacgac
aaggcaaacccaaggatcgctgttataaatttaaaagactttgagacaactcaaatggtc
gtaaaccctatcatgaagagtgagcacggcggtagcttcatcactccaaacagcgagtac
gtcatcgaagctagccagtacgcagctccacttgatgataactaccactcaatggacgac
tacgaagccgtttatagaggcgctgtgacattttggaaatttgactatccaaaaggtaag
atcgacgagaaagcatctttctctcttgagcttcctccatactggcaagacctaagcgac
gctggtaagggcgagagctacggctggggctttacaaactcaataaacactgagatgtat
acaggtggtatcgaaaaaggtcttcctccatttgaggcgggtgctagtagaaatgacacc
gacttcttacatgtttataactggcaaattttagaaaaacttgcacaagacaagaaaaac
tacaaagttataaatggtcatagagtgattacaatagaagctgctgttaaagctggagca
ctatttttgatcccagagtcaaagagcccacacggttgtgacgtaacaccagatggtaga
tacatcatcgttggcggtaagcttgatactcacgcatcagtttatgactttaaaaagatc
aaagagctaatcgacaaaaaagagttcgctggcactgacccatacggcatacctatccta
gatagagaaaagtcaatgcacggacaagtcgaacttggccttggaccactgcacacatca
tttgactcacaagatggcatactttatacttcactttacgttgatagccaaatcgtaaaa
tgggactacaaaaatttaaaagtgcttgataaggtaaatgttcattacaacatcggtcac
cttgatacaatggagggcaaatcagcaaaacctaagggcaaatacgcaatcgcacttgat
aaactttcaatcgatcgctttaacccagttggcccacttcatccacaaaaccaccagtta
atagacatcactggtgcaaaaatggatctaatctatgatatgcctatcccacttggtgaa
ccacacgacgttgtctcaatcgctgctagcaaactaactccagcgcttacttacaacatg
ggtacaaactcaagaacaggcgaggctagcccatacgcaaccctagctggtcaagaaaga
gttgagagaaacggcaaaaacgtaactgtctatgcgacaatgatcagaagccacatcaac
ccagagcacatcgaggtaaataaaggcgataacgtaacaattcacctaacaaacctagag
cgcgctcaagatgagactcacggctttggcatcgacctttacaacatccacgcttcactt
gagcctggcaaaactgcttcagtaaatttcgtagctgatatggaaggtgtcttcccatac
tactgcaccgagttttgttcagcacttcacctagagatgatgggttacttacttgttaaa
gatccaaataaaaaatatgaatctgcaaaaaatagcaagctaaaaactctaagtccagag
gctctaaaagctgagtacgacaaagtaatcgcaactaacaaagctactgatgatgttatc
caagaggttgttaaatacctaaaagagaaacattatgagaaatatccaaaagtaaaagct
ttggttgatgacgcacttgatcaatacggccacatcaaagaggtaaaagctaaagctgac
gaggcttacaaaaaaggcgacgtaaatggcgctatcctttgggagtaccaagtatggcaa
tacatggtaaaaactgccgacgttggtctaagagctaaaaacaacctagctaaagagatc
gcaactccgatgagcccagctgctgcaaaaggcgaagaagcttatctaaaaggcggatgt
aatggctgccacgttatcggtcaagtaagctcaggtccagacctaactggtgtcttgcta
agacatgaaaacggcgaaaaatgggtagcagactttataaaagatcctgctaaattctat
aacgatgactacgttaaagcgatgattgacttctttaaacttagaatgccaaatcagcac
atgagtgacgaagagatcaaaaatatcatccagtatctaaaatggatagacgaaaacgca
ggtatgtag

DBGET integrated database retrieval system