KEGG   Campylobacter concisus 13826: CCC13826_1740Help
Entry
CCC13826_1740     CDS       T00593                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cco  Campylobacter concisus 13826
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cco00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cco00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1879284..1880567)
Genome map
AA seq 427 aa AA seqDB search
MKISVENSFITDDSNECEQGAYFVQTTANAKFVEHAAKNGAKIITLEECKKLLKIDENLK
IVGITGTNGKTTTAAAIYETLRNLGKKCGLSGTRGAFIEGEQIDDKALTTSAILKTLSYL
KAASEQGCEYFVMEVSSHAIAQKRIESLNFALKIFTNLTQDHLDYHKSMEEYARVKSSFF
DDESVKLINIDDGGVKFNPKNAYTYAIKKPASFAPIVYGLKDGIDAVIKTPNGDVEIDSS
LQGEFNLYNLIAALGAVCLLERPDAAALSKAISKFKGVSGRMEVVSTDPLVIVDFAHTPD
GIEKVLNSLRHLNLIAVFGAGGDRDRTKRPKMGAIAQKYARICIVTSDNPRSEEPESIID
EICAGMSQNENLIRNANRKEAIALAISKLEPGWALVILGKGDEPYQEIKGVKHPFSDKEV
VIELLKR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatcagtagaaaatagcttcataacagatgactcaaacgagtgcgagcagggt
gcatactttgtgcaaactactgcaaatgcgaaatttgtagaacacgcagcaaaaaatggc
gctaagataatcacccttgaagagtgcaaaaagcttttaaaaatagacgaaaatttaaaa
atagttggcatcacaggcaccaatggcaagaccacaacggctgcggccatctacgagacc
ctgcgaaatttaggtaaaaaatgcggcctaagtggcaccaggggggcatttatagagggc
gagcagatagatgacaaggcgcttacgacaagtgccattttaaagacgctctcatacctc
aaagcagccagcgagcagggctgtgagtacttcgtgatggaggttagctcacacgcgatc
gctcaaaaacgcatagagagcttaaattttgctcttaaaatttttacaaacctaacgcaa
gatcacctagactaccacaagagcatggaggagtacgcgagggtaaaatcaagctttttt
gatgatgagagcgtaaagctcataaacattgacgatggtggagttaaatttaacccaaaa
aacgcctacacatacgcgatcaaaaagccagctagctttgcgccgatagtttatgggcta
aaggacggcatagacgcagttatcaagacgccaaatggcgatgtggagatagactcaagc
cttcaaggcgagtttaatctttacaacctaatcgcagcacttggtgccgtttgcttacta
gagcgcccagacgcagccgcactttcaaaggcgataagtaaatttaaaggtgtgagcggc
aggatggaggtcgttagcaccgatccgctagtcatcgtggattttgctcatacgccagat
ggcatagaaaaggtgctaaactcgcttagacatctaaatttgatcgcagtttttggcgca
ggtggcgacagagataggacaaagcgccctaaaatgggagcgatagcccaaaaatacgca
agaatttgcatcgtcacaagcgacaatccaagaagtgaagagccagagagcataatcgat
gaaatttgcgctggcatgagccaaaatgaaaatttgatacgaaacgccaaccgcaaagag
gcgatcgctctagccattagcaagctagagcccggctgggcgcttgtcatacttggcaaa
ggcgacgagccatatcaggagataaagggcgtcaagcacccatttagcgacaaagaagtt
gtaattgagcttttaaagaggtaa

DBGET integrated database retrieval system